DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and Bak1

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_446264.1 Gene:Bak1 / 116502 RGDID:621635 Length:209 Species:Rattus norvegicus


Alignment Length:243 Identity:53/243 - (21%)
Similarity:95/243 - (39%) Gaps:39/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AGGPGSVPNPSNGRSLHAGGPMTRAASTSSLASSTRTMTNYQEYKMDIINQGKCLCGQYIRARLR 114
            |.|.|  |.|..|....|     .:||...:|..|..:  ::.|..            |:..:.:
  Rat     2 ASGQG--PGPPKGDCDEA-----LSASEQQVAQDTEEV--FRSYVF------------YLHQQEQ 45

  Fly   115 RAGVLNRKVTQRLRNI-LDPGSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELED 178
            ............:.|: |:|.|  |:.:|...|..:|:::.|.:...:.|:..||........| 
  Rat    46 ETQGAAAPANPEMDNLSLEPNS--VLGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYE- 107

  Fly   179 SDMAPMLLNLVAKDLFRSSITWGKIISIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEII-EDDLV 242
                  |...:|..||:|.|:||:::::.......|:...::|...:|..:...||:|| ...:.
  Rat   108 ------LFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIA 166

  Fly   243 YWLIDNGGWL-GLSRHIRPRVGEFTFLGWLTLFVTISAGAYMVSNVCR 289
            .|:...|||: .||....|      .|..:.:|..:..|.::|....|
  Rat   167 RWIAQRGGWVAALSLRRDP------ILSVVVIFGVVLLGQFVVHRFFR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 35/152 (23%)
Bak1NP_446264.1 Bcl-2_like 27..181 CDD:132900 36/176 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.