DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and bok

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_002936655.1 Gene:bok / 100491111 XenbaseID:XB-GENE-988663 Length:214 Species:Xenopus tropicalis


Alignment Length:210 Identity:69/210 - (32%)
Similarity:108/210 - (51%) Gaps:32/210 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DIINQGKCLCGQYIRARLRRAGVLNRKVTQRLRNILDPGSSHVVYEVFPALNSMGEELERMHPRV 160
            ::::|||.:|..:|:|||:|||:...|......|    .|:..:.|:......:|:|||.|.|.|
 Frog    26 ELVSQGKAICRDFIQARLQRAGLGWSKPEHGKSN----ASAGRLAEISTTFLRLGDELEYMRPTV 86

  Fly   161 YTNISRQLSRAPFGE--LEDSDMAPMLLNLVAKDLFRSSITWGKIISIFAVCGGFAIDCVRQGHF 223
            |.||:|||:.:...|  |.|:.:|      ||.::|.:.|||||::|::||..|.|:|||:|...
 Frog    87 YRNIARQLNISLTSETILSDAFLA------VAAEIFTAGITWGKVVSLYAVAAGLAVDCVKQSQP 145

  Fly   224 DYLQCLIDGLAEIIEDDLVYWLIDNGGWLGLSRHIRPRVGEFTFLGWLTLFVTISAGA---YMVS 285
            ..:..::|.|.|.|...||.||...|||..:.:.:                ||...|.   ::||
 Frog   146 ALVLTIVDCLGEFIRKTLVTWLKRRGGWADIMKCV----------------VTTDPGLRAHWLVS 194

  Fly   286 NVCRRIGGQLYSLLF 300
            :.| ..|..|.::.|
 Frog   195 SAC-NFGHFLKAVFF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 56/151 (37%)
bokXP_002936655.1 Bcl-2_like 30..179 CDD:132900 60/158 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7819
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I4740
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1278637at2759
OrthoFinder 1 1.000 - - FOG0005475
OrthoInspector 1 1.000 - - otm47715
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3895
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.