DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT1G51210

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_175532.1 Gene:AT1G51210 / 841544 AraportID:AT1G51210 Length:433 Species:Arabidopsis thaliana


Alignment Length:465 Identity:94/465 - (20%)
Similarity:170/465 - (36%) Gaps:145/465 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IAGAHGANILGLFTSLSPSHLVIQMSMARILAERGHNVTVVTILKPPSLHKDINHILVPMEEDIL 80
            |.|:...:|: :|...:..||:..:.:...|..||  :||..|:.|.:|         |....:|
plant    13 IRGSLKPHIM-VFPYPAQGHLLPLLDLTHQLCLRG--LTVSIIVTPKNL---------PYLSPLL 65

  Fly    81 QAFNSVV--------------GGMTKTDNSNAYVS--MFRSVRQLSETFSKMGDVMKQPLVKDLY 129
            .|..|.|              .|:....:...|.:  :..|:|||           ::|:|..|.
plant    66 SAHPSAVSVVTLPFPHHPLIPSGVENVKDLGGYGNPLIMASLRQL-----------REPIVNWLS 119

  Fly   130 EHPDNKFDLVMVGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYL--LGNPWEVSYVPGMSVSIK 192
            .||:                         |.|..:|:  .|||:.  ||.|....:..|..::  
plant   120 SHPN-------------------------PPVALISD--FFLGWTKDLGIPRFAFFSSGAFLA-- 155

  Fly   193 GGKPLGFGHRVLNLLGSMAQRLFMF-------IIELRNARIYREIYGDD--PTLPSYEDLHK-NI 247
                        ::|..::.:..:|       :.:|..:.:::..:...  |..|..:||.. ..
plant   156 ------------SILHFVSDKPHLFESTEPVCLSDLPRSPVFKTEHLPSLIPQSPLSQDLESVKD 208

  Fly   248 SLIFFASHG--------------------ISEGPIRPNVPAVIEIGGI-QVKEQPERLPQNME-- 289
            |.:.|:|:|                    :||.       .|..:|.: .|....|....|::  
plant   209 STMNFSSYGCIFNTCECLEEDYMEYVKQKVSEN-------RVFGVGPLSSVGLSKEDSVSNVDAK 266

  Fly   290 ---QFLSEAPNGAIL-LSLGSNLKEDHLKSSTVQKMFNV---LSKLQQKVIW--KWDDL-----D 340
               .:|...|:.::| :..||.      |..|.::..::   |.|...:.:|  |.|.:     |
plant   267 ALLSWLDGCPDDSVLYICFGSQ------KVLTKEQCDDLALGLEKSMTRFVWVVKKDPIPDGFED 325

  Fly   341 NIPGESENILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMV 405
            .:.|  ..::...|.|||.:|:|..:..|:.|.|...:.||...|..:||.|:..||..:|.::|
plant   326 RVAG--RGMIVRGWAPQVAMLSHVAVGGFLIHCGWNSVLEAMASGTMILAWPMEADQFVDARLVV 388

  Fly   406 MHGFGIKQSI 415
            .| .|:..|:
plant   389 EH-MGVAVSV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 94/465 (20%)
egt 13..483 CDD:223071 94/465 (20%)
AT1G51210NP_175532.1 Glycosyltransferase_GTB-type 18..432 CDD:385653 92/460 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.