DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT78D1

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_564357.1 Gene:UGT78D1 / 839933 AraportID:AT1G30530 Length:453 Species:Arabidopsis thaliana


Alignment Length:267 Identity:53/267 - (19%)
Similarity:91/267 - (34%) Gaps:87/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 FIIELRNARIYREIYGDDPTLPSYEDLHK--------------NISLIFFASHGISEGPIRPNVP 267
            ||..:.|.|:     .|.|....:|||..              ..|.:|.:|....|..:..|  
plant   173 FIPGMENYRV-----KDIPEEVVFEDLDSVFPKALYQMSLALPRASAVFISSFEELEPTLNYN-- 230

  Fly   268 AVIEIGGIQVKEQPERLPQNMEQFLSEAPNGAILLSLGSNLKEDHLKS----------------- 315
                            |...:::||:.||     |:|.|:..|..::.                 
plant   231 ----------------LRSKLKRFLNIAP-----LTLLSSTSEKEMRDPHGCFAWMGKRSAASVA 274

  Fly   316 ----STV-----QKMFNVLSKLQ-QKVIWKWD----DLDNIP-----GESENILYSKWVPQVDVL 361
                .||     :::..:...|: .||.:.|.    ::.::|     ...|..:...|.|||::|
plant   275 YISFGTVMEPPPEELVAIAQGLESSKVPFVWSLKEKNMVHLPKGFLDRTREQGIVVPWAPQVELL 339

  Fly   362 AHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSN---------ADVMVMHGFGIKQSILT 417
            .|..:.:.:||.|...:.|:...|.||:..|:..|...|         ..||:.:|...|:....
plant   340 KHEAMGVNVTHCGWNSVLESVSAGVPMIGRPILADNRLNGRAVEVVWKVGVMMDNGVFTKEGFEK 404

  Fly   418 LEEDSFL 424
            ...|.|:
plant   405 CLNDVFV 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 53/267 (20%)
egt 13..483 CDD:223071 53/267 (20%)
UGT78D1NP_564357.1 GT1_Gtf-like 12..432 CDD:340817 53/267 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.