DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT85A7

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_173652.1 Gene:UGT85A7 / 838841 AraportID:AT1G22340 Length:487 Species:Arabidopsis thaliana


Alignment Length:475 Identity:96/475 - (20%)
Similarity:178/475 - (37%) Gaps:128/475 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVVTILKPPSLHKDINHILVPMEEDILQA-----FNSVVGGMTKTD 94
            |:...:.:|::|..:|.:||.|..|      .:.|.:|.....:.|..     |.|:..|:.:||
plant    24 HINPMLKVAKLLYAKGFHVTFVNTL------YNHNRLLRSRGPNALDGFPSFRFESIPDGLPETD 82

  Fly    95 NSNAYVSMFRSVRQLSETFSKMGDVMKQPLV--KDLYEHPDNKFDLVMVGYFMN----CYQLALA 153
            ..           :...|.:....:.|..|.  |::....::|.|:..|...::    .:.|..|
plant    83 GD-----------RTQHTPTVCMSIEKNCLAPFKEILRRINDKDDVPPVSCIVSDGVMSFTLDAA 136

  Fly   154 HKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGFGH--RVLNLLGSMAQRLFM 216
            .:|.||.|:..:|  |..|::....:.:....|:| ..|....:...|  .|::.:.||      
plant   137 EELGVPEVIFWTN--SACGFMTILHFYLFIEKGLS-PFKDESYMSKEHLDTVIDWIPSM------ 192

  Fly   217 FIIELRNARIYREIYGDDPTLPSY-----EDLHKNISLIFF--------------------ASHG 256
                 :|.|:        ..:|||     .|   ||.|.|.                    ..|.
plant   193 -----KNLRL--------KDIPSYIRTTNPD---NIMLNFLIREVERSKRASAIILNTFDELEHD 241

  Fly   257 ISEGPIRPNVPAVIEIGGIQ--VKEQPERLPQNMEQFL--------------SEAPNGAILLSLG 305
            :.:. ::..:|.|..||.:.  |||:.....:..:..|              ::.||..:.::.|
plant   242 VIQS-MQSILPPVYSIGPLHLLVKEEINEASEIGQMGLNLWREEMECLDWLDTKTPNSVLFVNFG 305

  Fly   306 SNLKEDHLKSSTVQKMFNVLSKLQQKVIW-------KWDDLDNIPGE--SENI---LYSKWVPQV 358
            ....   :.:..:::....|:..:::.:|       ..:.:..:|.|  :|.|   :.:.|.||.
plant   306 CITV---MSAKQLEEFAWGLAASRKEFLWVIRPNLVVGEAMVVLPQEFLAETIDRRMLASWCPQE 367

  Fly   359 DVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMH-GFGI-------KQSI 415
            .||:||.|..|:||.|.....|:...|.||:..|.|.:||:|....... |.||       ::.:
plant   368 KVLSHPAIGGFLTHCGWNSTLESLAGGVPMICWPCFSEQPTNCKFCCDEWGVGIEIGKDVKREEV 432

  Fly   416 LTLEEDSFLQGIREVLDNPK 435
            .|:        :||::|..|
plant   433 ETV--------VRELMDGEK 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 96/475 (20%)
egt 13..483 CDD:223071 96/475 (20%)
UGT85A7NP_173652.1 Glycosyltransferase_GTB-type 12..481 CDD:385653 96/475 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.