DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT1G01390

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001322773.1 Gene:AT1G01390 / 837790 AraportID:AT1G01390 Length:497 Species:Arabidopsis thaliana


Alignment Length:455 Identity:100/455 - (21%)
Similarity:176/455 - (38%) Gaps:113/455 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QIVVLIAGAHGANILGLFTSLSPSHLVIQMSMARILAERGHNVTVVTIL----KPPSLHKDINHI 71
            :|::|:|.|:..:| .:..|....||:..:.:|:.|.:  |:...||::    ..||        
plant    13 KILLLMAEANTPHI-AIMPSPGMGHLIPFVELAKRLVQ--HDCFTVTMIISGETSPS-------- 66

  Fly    72 LVPMEEDILQAFNSVVGGM------------TKTDNSNAYVSMFRSVRQLSETFSKMGDVMKQP- 123
              ..:..:|.:..|.:..:            |....:.|.::|.||...|.|.|..:......| 
plant    67 --KAQRSVLNSLPSSIASVFLPPADLSDVPSTARIETRAMLTMTRSNPALRELFGSLSTKKSLPA 129

  Fly   124 -LVKDLYEHPDNKFDLVMVGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYLLGNP-------WE 180
             ||.|::  ..:.|| |.|.:.::            |.:...|| .:.|.:.|..|       .|
plant   130 VLVVDMF--GADAFD-VAVDFHVS------------PYIFYASN-ANVLSFFLHLPKLDKTVSCE 178

  Fly   181 VSYVPGMSVSIKGGKPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHK 245
            ..|:. ..:.|.|..|: .|...|:.:.......:..:  |.|.:.|:|..|  ..:.|:.||..
plant   179 FRYLT-EPLKIPGCVPI-TGKDFLDTVQDRNDDAYKLL--LHNTKRYKEAKG--ILVNSFVDLES 237

  Fly   246 NISLIFFASHGISEGPIRPNVPAVIEIGGIQVKEQPERLPQNME------QFLSEAPNGAIL-LS 303
            |      |...:.|.  .|:.|.|..||.: |......:  |:|      .:|...|.|::| :|
plant   238 N------AIKALQEP--APDKPTVYPIGPL-VNTSSSNV--NLEDKFGCLSWLDNQPFGSVLYIS 291

  Fly   304 LGSNLKEDHLKSSTVQKMFNV----LSKLQQKVIW------------------KWDDLDNIP--- 343
            .||.       .:...:.||.    |::..::.||                  :.|....:|   
plant   292 FGSG-------GTLTCEQFNELAIGLAESGKRFIWVIRSPSEIVSSSYFNPHSETDPFSFLPIGF 349

  Fly   344 ---GESENILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMV 405
               .:.:.::...|.|||.:||||:...|:||.|.....|:..:|.|::|.|:|.:|..|..::|
plant   350 LDRTKEKGLVVPSWAPQVQILAHPSTCGFLTHCGWNSTLESIVNGVPLIAWPLFAEQKMNTLLLV 414

  Fly   406  405
            plant   415  414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 100/454 (22%)
egt 13..483 CDD:223071 99/453 (22%)
AT1G01390NP_001322773.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.