DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT71C4

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_563784.2 Gene:UGT71C4 / 837236 AraportID:AT1G07250 Length:479 Species:Arabidopsis thaliana


Alignment Length:470 Identity:99/470 - (21%)
Similarity:172/470 - (36%) Gaps:117/470 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SPSHLVIQMSMARILAERGHNVTVVTIL---KPPSLHKDI-------------NHILVPMEE--- 77
            |..|:::.:..|:.|....|.:..:|||   .|.|.|..:             .|.|.|:::   
plant    14 STGHILVHIEFAKRLINLDHRIHTITILNLSSPSSPHASVFARSLIASQPKIRLHDLPPIQDPPP 78

  Fly    78 -DILQ-AFNSVVGGMTKTDN---SNAYVSMFRSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFD 137
             |:.| |..:.:..:.|.:.   .:|..|:..|.|..|::....|      ||.||         
plant    79 FDLYQRAPEAYIVKLIKKNTPLIKDAVSSIVASRRGGSDSVQVAG------LVLDL--------- 128

  Fly   138 LVMVGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGFGHR 202
                  |.|.....:.::|.:|..:.|:....:||.:       .|:|.....|.....|..|..
plant   129 ------FCNSLVKDVGNELNLPSYIYLTCNARYLGMM-------KYIPDRHRKIASEFDLSSGDE 180

  Fly   203 VLNLLG--------SMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFA------ 253
            .|.:.|        .|...||       |...| |.|.:  ..|.:.|. |.|.:..|.      
plant   181 ELPVPGFINAIPTKFMPPGLF-------NKEAY-EAYVE--LAPRFADA-KGILVNSFTELEPHP 234

  Fly   254 ----SHGISEGPIRPNVPAVIEIGGIQVKEQPERLPQNMEQ---FLSEAPNGAIL-LSLGSNLKE 310
                ||.....|:.|..|    |..::.:..|.....:.:|   :|.:.|..::: |..||....
plant   235 FDYFSHLEKFPPVYPVGP----ILSLKDRASPNEEAVDRDQIVGWLDDQPESSVVFLCFGSRGSV 295

  Fly   311 DHLKSSTVQKMFNVLSKLQQKVIWK---WDDLDNIPGE----------SENILYSKWVPQVDVLA 362
            |   ...|:::...|..:..:.:|.   ..|::..|.:          :...|...|.|||:|||
plant   296 D---EPQVKEIARALELVGCRFLWSIRTSGDVETNPNDVLPEGFMGRVAGRGLVCGWAPQVEVLA 357

  Fly   363 HPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMH-GFGI---------KQSILT 417
            |..|..|::|.|.....|:.:.|.|:...|::.:|..||..:|.. |..:         :..::|
plant   358 HKAIGGFVSHCGWNSTLESLWFGVPVATWPMYAEQQLNAFTLVKELGLAVDLRMDYVSSRGGLVT 422

  Fly   418 LEEDSFLQGIREVLD 432
            .:|  ..:.:|.::|
plant   423 CDE--IARAVRSLMD 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 99/470 (21%)
egt 13..483 CDD:223071 99/470 (21%)
UGT71C4NP_563784.2 PLN02167 2..477 CDD:215112 99/470 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.