DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT71C5

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_172204.1 Gene:UGT71C5 / 837235 AraportID:AT1G07240 Length:480 Species:Arabidopsis thaliana


Alignment Length:504 Identity:99/504 - (19%)
Similarity:173/504 - (34%) Gaps:162/504 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVVTILK---PPSLHKD------------INHILVPMEED-----I 79
            ||:..:...:.|......::::|||.   |.:.|.|            |..|.:|...|     :
plant    16 HLLSTIEFGKRLLNLDRRISMITILSMNLPYAPHADASLASLTASEPGIRIISLPEIHDPPPIKL 80

  Fly    80 LQAFNSVVGGMTKTDNSNAYVSMF--RSVRQLSETFSKMGDVMKQPLVKDLYEHPDNK------- 135
            |..            :|..|:..|  :::..|.:|            ::||.....:.       
plant    81 LDT------------SSETYILDFIHKNIPCLRKT------------IQDLVSSSSSSGGGSSHV 121

  Fly   136 ----FDLVMVGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYL---------------------- 174
                .|...||.      :.:..::.:|..:.:::...|||.|                      
plant   122 AGLILDFFCVGL------IDIGREVNLPSYIFMTSNFGFLGVLQYLPERQRLTPSEFDESSGEEE 180

  Fly   175 LGNPWEVSYV------PGMSVSIKGGKPLGFGHRVLN----LLGSMAQRLFMFIIELRNARIYRE 229
            |..|..|:.|      ||:...:..|..:..|.|:..    |:.|..|............|.|..
plant   181 LHIPAFVNRVPAKVLPPGVFDKLSYGSLVKIGERLHEAKGILVNSFTQVEPYAAEHFSQGRDYPH 245

  Fly   230 IYGDDPTLPSYEDLHKNISLIFFASHGISEGPIRPNVPAVIEIGGIQVKEQPERLPQNMEQFLSE 294
            :|...|.|        |::           |...|.      :...|.||        |.::|.|
plant   246 VYPVGPVL--------NLT-----------GRTNPG------LASAQYKE--------MMKWLDE 277

  Fly   295 APNGAIL-LSLGSNLKEDHLKSSTVQKMFNVLSKLQQKVIWKWDDLDNIPGESE----------- 347
            .|:.::| |..||   .....:..:.::.:.|..:..:.||.  ...|:.|:.:           
plant   278 QPDSSVLFLCFGS---MGVFPAPQITEIAHALELIGCRFIWA--IRTNMAGDGDPQEPLPEGFVD 337

  Fly   348 -----NILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMH 407
                 .|:.| |.||||:|||.....|::|.|...:.|:.::|.|:...|::.:|..||..||..
plant   338 RTMGRGIVCS-WAPQVDILAHKATGGFVSHCGWNSVQESLWYGVPIATWPMYAEQQLNAFEMVKE 401

  Fly   408 -GFGIKQSILTLEEDSFLQGIR---EVLDNPKYATAVKSFSTLYRDRPL 452
             |..::     :..|....|.|   |::...:.||||:|.  :..|.|:
plant   402 LGLAVE-----IRLDYVADGDRVTLEIVSADEIATAVRSL--MDSDNPV 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 99/504 (20%)
egt 13..483 CDD:223071 99/504 (20%)
UGT71C5NP_172204.1 PLN02167 1..480 CDD:215112 99/504 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.