DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT74E2

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_172059.1 Gene:UGT74E2 / 837075 AraportID:AT1G05680 Length:453 Species:Arabidopsis thaliana


Alignment Length:476 Identity:103/476 - (21%)
Similarity:167/476 - (35%) Gaps:151/476 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVVTILKPPS-----LH-------------------KDINHILVPM 75
            |:.......:.||.:|..:|:|.:...||     .|                   :|::..:..:
plant    17 HITPMSQFCKRLASKGLKLTLVLVSDKPSPPYKTEHDSITVFPISNGFQEGEEPLQDLDDYMERV 81

  Fly    76 EEDILQAFNSVVGGMTKTDN---SNAYVSMFRSVRQLSETFSKMGDV-MKQP-LVKDLYEH---- 131
            |..|......:|..|..:.|   :..|.|....:..::.::...|.| ..|| ||..:|.|    
plant    82 ETSIKNTLPKLVEDMKLSGNPPRAIVYDSTMPWLLDVAHSYGLSGAVFFTQPWLVTAIYYHVFKG 146

  Fly   132 ----PDNKFDLVMVGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGM----- 187
                |..|:.           ...||.....|::.| ::.||||       .|.|..|.:     
plant   147 SFSVPSTKYG-----------HSTLASFPSFPMLTA-NDLPSFL-------CESSSYPNILRIVV 192

  Fly   188 -------SVSIKGGKPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDPTLPSY----- 240
                   .|.|.          :.|....:.::|..::..|      ..:....||:||.     
plant   193 DQLSNIDRVDIV----------LCNTFDKLEEKLLKWVQSL------WPVLNIGPTVPSMYLDKR 241

  Fly   241 --EDLHKNISLIFFASHGISEGPIRPNVPAVIEIGGIQVKEQPERLPQNMEQFLSEAPNGAILLS 303
              ||  ||.....|.:                            ::.:.||...|:.||..:.||
plant   242 LSED--KNYGFSLFNA----------------------------KVAECMEWLNSKEPNSVVYLS 276

  Fly   304 LGS--NLKEDHLKSSTVQKMFNVLSKLQQK---VIW--KWDDLDNIPGE-----SENILYSKWVP 356
            .||  .||||        :|..:.:.|:|.   .:|  :..:...:|..     .|..|...|.|
plant   277 FGSLVILKED--------QMLELAAGLKQSGRFFLWVVRETETHKLPRNYVEEIGEKGLIVSWSP 333

  Fly   357 QVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMV-MHGFGIKQSILTLEE 420
            |:|||||.:|..|:||.|.....|....|.||:.:|.:.|||:||..|. :...|::   :..|.
plant   334 QLDVLAHKSIGCFLTHCGWNSTLEGLSLGVPMIGMPHWTDQPTNAKFMQDVWKVGVR---VKAEG 395

  Fly   421 DSF------LQGIREVLDNPK 435
            |.|      ::.:.||::..|
plant   396 DGFVRREEIMRSVEEVMEGEK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 103/476 (22%)
egt 13..483 CDD:223071 103/476 (22%)
UGT74E2NP_172059.1 Glycosyltransferase_GTB-type 6..450 CDD:415824 103/476 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.