DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT75B2

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_172044.1 Gene:UGT75B2 / 837055 AraportID:AT1G05530 Length:455 Species:Arabidopsis thaliana


Alignment Length:413 Identity:88/413 - (21%)
Similarity:158/413 - (38%) Gaps:71/413 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LFTSLSPSHLVIQMSMA-RILAERGHNVTVVTILKPPSLHKDI--NHILVPMEEDILQAFNSV-- 86
            |.|..:..|:...:..| |::...|..||..|.|.  .:|:.:  ||             |:|  
plant     8 LVTFPAQGHVNPSLRFARRLIKTTGARVTFATCLS--VIHRSMIPNH-------------NNVEN 57

  Fly    87 VGGMTKTDN-SNAYVSMFRSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFDLVMVGYFMNCYQL 150
            :..:|.:|. .:..:|....|:.....|.:.||......: :..::.|:....::.....| :..
plant    58 LSFLTFSDGFDDGVISNTDDVQNRLVHFERNGDKALSDFI-EANQNGDSPVSCLIYTILPN-WVP 120

  Fly   151 ALAHKLKVPLVVALSNP----PSFLGYLLGN--PWEVSYVPGMSVSIKGGKPLGFGHRVLNLLG- 208
            .:|.:..:|.|.....|    ..:..|..||  .:|...:|.:.:.   ..|........|... 
plant   121 KVARRFHLPSVHLWIQPAFAFDIYYNYSTGNNSVFEFPNLPSLEIR---DLPSFLSPSNTNKAAQ 182

  Fly   209 SMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFASHGISEGPIRPNVPAVIEIG 273
            ::.|.|..|:.|..|.:|....:  |...|.:.....||.:       ::.||:   :||.|..|
plant   183 AVYQELMDFLKEESNPKILVNTF--DSLEPEFLTAIPNIEM-------VAVGPL---LPAEIFTG 235

  Fly   274 GIQVKEQPERLPQNMEQFL---SEAPNGAILLSLGSNLKEDHLKSSTVQKMFNVLSKLQQKVIWK 335
            ....|:. .|..|:....|   |:..:..|.:|.|:.::   |....::::...|.:..:..:|.
plant   236 SESGKDL-SRDHQSSSYTLWLDSKTESSVIYVSFGTMVE---LSKKQIEELARALIEGGRPFLWV 296

  Fly   336 WDDLDN----IPGESENILYS---------------KWVPQVDVLAHPNITLFITHAGKGGLTEA 381
            ..|..|    |.||.|..:..               .|..|::||.|..|..|:||.|.....|:
plant   297 ITDKLNREAKIEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEVLRHRAIGCFLTHCGWSSSLES 361

  Fly   382 QYHGKPMLALPVFGDQPSNADVM 404
            ...|.|::|.|::.|||:||.::
plant   362 LVLGVPVVAFPMWSDQPANAKLL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 88/413 (21%)
egt 13..483 CDD:223071 88/413 (21%)
UGT75B2NP_172044.1 PLN02152 1..455 CDD:177813 88/413 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.