DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT72E2

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_201470.1 Gene:UGT72E2 / 836802 AraportID:AT5G66690 Length:481 Species:Arabidopsis thaliana


Alignment Length:520 Identity:102/520 - (19%)
Similarity:166/520 - (31%) Gaps:213/520 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IAGAHGANILGLFTSLSPSHLVIQMSMA-RILAERGHNVTV-------------------VTILK 60
            |...|.|    :|:|....|::..:.:. |:.|..|.:|||                   |.|:|
plant     3 ITKPHAA----MFSSPGMGHVIPVIELGKRLSANNGFHVTVFVLETDAASAQSKFLNSTGVDIVK 63

  Fly    61 PPSLHKDINHILVPMEEDILQAFNSVVGGMTKTDNSNAYVSMFRSVRQLSETFSKMGDVMKQP-- 123
            .||  .||..::.|.:..:.:     :|           |.|..:|..|.   ||:..:.::|  
plant    64 LPS--PDIYGLVDPDDHVVTK-----IG-----------VIMRAAVPALR---SKIAAMHQKPTA 107

  Fly   124 LVKDLYEHPDNKFDLVMVGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMS 188
            |:.||:                ....|.||.:..:...|.:.....|||..:       |.|.:.
plant   108 LIVDLF----------------GTDALCLAKEFNMLSYVFIPTNARFLGVSI-------YYPNLD 149

  Fly   189 VSIK-------------GGKPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDPTLPSY 240
            ..||             |.:|:.|           ...|..:::               |..|.|
plant   150 KDIKEEHTVQRNPLAIPGCEPVRF-----------EDTLDAYLV---------------PDEPVY 188

  Fly   241 EDLHKNISLIFFASHGISEGPIRPNVPAVIEIGGIQVKEQPERLPQNME---------------- 289
            .|         |..||:          |..:..||.|....|..|::::                
plant   189 RD---------FVRHGL----------AYPKADGILVNTWEEMEPKSLKSLLNPKLLGRVARVPV 234

  Fly   290 --------------------QFLSEAPNGAIL-LSLGSNLKEDHLKSSTVQKMFNVLSKLQQKVI 333
                                .:|:|.||.::| :|.||.   ..|.:..:.::...|.:.||:.:
plant   235 YPIGPLCRPIQSSETDHPVLDWLNEQPNESVLYISFGSG---GCLSAKQLTELAWGLEQSQQRFV 296

  Fly   334 W------------------KWDDLDNIP----------GESENILYSKWVPQVDVLAHPNITLFI 370
            |                  .....||.|          ......:...|.||.::|:|..:..|:
plant   297 WVVRPPVDGSCCSEYVSANGGGTEDNTPEYLPEGFVSRTSDRGFVVPSWAPQAEILSHRAVGGFL 361

  Fly   371 THAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMHGFGIKQSILTLEEDSFLQGIREVLDNPK 435
            ||.|.....|:...|.||:|.|:|.:|..||            ::|:.|     .||...||:||
plant   362 THCGWSSTLESVVGGVPMIAWPLFAEQNMNA------------ALLSDE-----LGIAVRLDDPK 409

  Fly   436  435
            plant   410  409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 102/520 (20%)
egt 13..483 CDD:223071 102/520 (20%)
UGT72E2NP_201470.1 PLN02992 1..481 CDD:178572 102/520 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.