DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT5G65550

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_201358.1 Gene:AT5G65550 / 836681 AraportID:AT5G65550 Length:466 Species:Arabidopsis thaliana


Alignment Length:524 Identity:92/524 - (17%)
Similarity:177/524 - (33%) Gaps:182/524 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LGLFTSLSPSHLVIQMSMARILAERGHNVTVVT----ILKPPSLHKD--INHILVPMEEDILQAF 83
            :.:|..|:..|::..:.:::::|.:||.|:.::    |.:.|::..|  :|.:.:|:.:.:....
plant    10 VAVFPWLALGHMIPYLQLSKLIARKGHTVSFISTARNISRLPNISSDLSVNFVSLPLSQTVDHLP 74

  Fly    84 NSVVGGMTKTDNSNAYVSMFRSVRQLSETFSKMGDVMKQP-LVKDLYEHPDNKFDLVMVGYFMNC 147
            .:........:...||:.  ::...|||.|::..:..|.. :|.|:..|                
plant    75 ENAEATTDVPETHIAYLK--KAFDGLSEAFTEFLEASKPNWIVYDILHH---------------- 121

  Fly   148 YQLALAHKLKVPLVVALS-NPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGFGHRVLNLLGSMA 211
            :...:|.||.|...:..: |..|.:  ::|.|        .||.|:|..|               
plant   122 WVPPIAEKLGVRRAIFCTFNAASII--IIGGP--------ASVMIQGHDP--------------- 161

  Fly   212 QRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFASHGISEGPIRPNVPAVIEIGGIQ 276
                            |:...|....|.:.....||....|.:..|.|.|       ...:.|::
plant   162 ----------------RKTAEDLIVPPPWVPFETNIVYRLFEAKRIMEYP-------TAGVTGVE 203

  Fly   277 VKEQPERLPQNMEQFLSEAPNGAILLSLGSNLKEDHLKSSTVQKMFNVLSKLQQKVI-------- 333
            :.:       |....|:...:..|::.....|:.:.::         :|||||.|.:        
plant   204 LND-------NCRLGLAYVGSEVIVIRSCMELEPEWIQ---------LLSKLQGKPVIPIGLLPA 252

  Fly   334 -----------W----KWDDL-------------------DNIPG-------------------- 344
                       |    :|.|.                   :.|.|                    
plant   253 TPMDDADDEGTWLDIREWLDRHQAKSVVYVALGTEVTISNEEIQGLAHGLELCRLPFFWTLRKRT 317

  Fly   345 --------------ESENILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFG 395
                          :...:::::||||..:|:|.::..|:||.|.|...|....|.|::..|...
plant   318 RASMLLPDGFKERVKERGVIWTEWVPQTKILSHGSVGGFVTHCGWGSAVEGLSFGVPLIMFPCNL 382

  Fly   396 DQPSNADVMVMHGFGIKQSILTLEED------SFLQGIREVLDNPKYATAVKSFSTLYRDRPLSP 454
            |||..|  .::.|..|...|...|.|      |..:.||.|:        |:....:||:...|.
plant   383 DQPLVA--RLLSGMNIGLEIPRNERDGLFTSASVAETIRHVV--------VEEEGKIYRNNAASQ 437

  Fly   455 RETL 458
            ::.:
plant   438 QKKI 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 92/524 (18%)
egt 13..483 CDD:223071 92/524 (18%)
AT5G65550NP_201358.1 Glycosyltransferase_GTB-type 7..461 CDD:385653 92/524 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.