DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT76E2

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_200767.1 Gene:UGT76E2 / 836078 AraportID:AT5G59590 Length:449 Species:Arabidopsis thaliana


Alignment Length:418 Identity:93/418 - (22%)
Similarity:149/418 - (35%) Gaps:110/418 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVV-TILKPPSLHKDIN--HILVPMEEDILQAFNSVVGGMTKTDNS 96
            |:...|.:.:.|..:|.::||| |.....|..||.:  |.|            ::.|.:|::|..
plant    21 HVTPMMQLGKALHSKGFSITVVLTQSNRVSSSKDFSDFHFL------------TIPGSLTESDLQ 73

  Fly    97 NAYVSMF-RSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFDLVMVGYFMNCYQLALAHKLKVPL 160
            |.....| ..:.|:.|.      ..||.:.:.|:|..:|....|:...:| .:..|...:.::|.
plant    74 NLGPQKFVLKLNQICEA------SFKQCIGQLLHEQCNNDIACVVYDEYM-YFSHAAVKEFQLPS 131

  Fly   161 VV-------------ALS--NPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGFGHRVLNLLGSM 210
            ||             .||  |..|||..:.....:....||:       .||.:.....::.|.:
plant   132 VVFSTTSATAFVCRSVLSRVNAESFLIDMKDPETQDKVFPGL-------HPLRYKDLPTSVFGPI 189

  Fly   211 AQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFASHGISEG------------PIR 263
            ...|          ::|.|....           :..|.:...|....|.            |:.
plant   190 ESTL----------KVYSETVNT-----------RTASAVIINSASCLESSSLARLQQQLQVPVY 233

  Fly   264 PNVPAVIEIGGIQV-KEQPERLPQN----MEQFLSEAPNGAILLSLGSNLKEDHLKSSTVQKMFN 323
            |       ||.:.: ...|..|.:.    :|....:..|..|.:||||....|   :..:.:|..
plant   234 P-------IGPLHITASAPSSLLEEDRSCVEWLNKQKSNSVIYISLGSLALMD---TKDMLEMAW 288

  Fly   324 VLSKLQQKVIW----------KWDDLDNIPGE-----SENILYSKWVPQVDVLAHPNITLFITHA 373
            .||...|..:|          :|  .:::|.|     ||.....||.||::||.||.:..|.:|.
plant   289 GLSNSNQPFLWVVRPGSIPGSEW--TESLPEEFNRLVSERGYIVKWAPQMEVLRHPAVGGFWSHC 351

  Fly   374 GKGGLTEAQYHGKPMLALPVFGDQPSNA 401
            |.....|:...|.||:..|..|||..||
plant   352 GWNSTVESIGEGVPMICRPFTGDQKVNA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 93/418 (22%)
egt 13..483 CDD:223071 93/418 (22%)
UGT76E2NP_200767.1 Glycosyltransferase_GTB-type 1..449 CDD:415824 93/418 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.