DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT76E1

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_200766.2 Gene:UGT76E1 / 836077 AraportID:AT5G59580 Length:453 Species:Arabidopsis thaliana


Alignment Length:520 Identity:106/520 - (20%)
Similarity:186/520 - (35%) Gaps:160/520 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GISRCLALQIVVLIAGAHGANILGLFTSLSPSHLVIQMSMARILAERGHNVTVV-TILKPPSLHK 66
            |:.|    :||::...|.|             |:...|.:.:.|..:|.::||| |.....|..|
plant     5 GVKR----RIVLVPVPAQG-------------HVTPIMQLGKALYSKGFSITVVLTQYNRVSSSK 52

  Fly    67 DIN--HILVPMEEDILQAFNSVVGGMTKTD--NSNAYVSMFRSVRQLSETFSKMGDVMKQPLVKD 127
            |.:  |.|            ::.|.:|::|  |...:..:|: :.|:.|...|.       .:..
plant    53 DFSDFHFL------------TIPGSLTESDLKNLGPFKFLFK-LNQICEASFKQ-------CIGQ 97

  Fly   128 LYEHPDNKFDLVMVGYFMNCYQLALAHKLKVPLVV-------------ALS--NPPSFLGYLLGN 177
            |.:...|....|:...:|...|.|: .:.::|.|:             .||  |..|||..:...
plant    98 LLQEQGNDIACVVYDEYMYFSQAAV-KEFQLPSVLFSTTSATAFVCRSVLSRVNAESFLLDMKDP 161

  Fly   178 PWEVSYVPGMSVSIKGGKPLGFGHRVLNLLGSMAQ--RLFMFIIELRNARIYREIYGDDPTL--P 238
            .......||:       .||.:.....:..|.:..  :::...:.:|.|...  |......|  .
plant   162 KVSDKEFPGL-------HPLRYKDLPTSAFGPLESILKVYSETVNIRTASAV--IINSTSCLESS 217

  Fly   239 SYEDLHKNISLIFFASHGISEGPIRPNVPAVIEIGGIQV-KEQPERL---PQNMEQFLSEAPNGA 299
            |...|.|.:.:           |:.|       ||.:.: ...|..|   .::..::|::...|:
plant   218 SLAWLQKQLQV-----------PVYP-------IGPLHIAASAPSSLLEEDRSCLEWLNKQKIGS 264

  Fly   300 IL-LSLGSNLKEDHLKSSTVQKMFNVLSKLQQKVIW----------KWDDLDNIPGE-----SEN 348
            :: :||||...   :::..:.:|...|....|..:|          :|  .:::|.|     ||.
plant   265 VIYISLGSLAL---METKDMLEMAWGLRNSNQPFLWVIRPGSIPGSEW--TESLPEEFSRLVSER 324

  Fly   349 ILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNAD----------- 402
            ....||.||::||.||.:..|.:|.|.....|:...|.||:..|..|||..||.           
plant   325 GYIVKWAPQIEVLRHPAVGGFWSHCGWNSTLESIGEGVPMICRPFTGDQKVNARYLERVWRIGVQ 389

  Fly   403 -----------------VMVMHGFGIKQSILTLEEDSFLQGIREVLDNPKYATAVK----SFSTL 446
                             :|...|..:::.::.|:|              |...:||    |||:|
plant   390 LEGELDKGTVERAVERLIMDEEGAEMRKRVINLKE--------------KLQASVKSRGSSFSSL 440

  Fly   447  446
            plant   441  440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 104/511 (20%)
egt 13..483 CDD:223071 103/510 (20%)
UGT76E1NP_200766.2 Glycosyltransferase_GTB_type 1..450 CDD:299143 106/520 (20%)
YjiC 7..429 CDD:224732 99/505 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.