DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT5G54010

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_200212.1 Gene:AT5G54010 / 835484 AraportID:AT5G54010 Length:453 Species:Arabidopsis thaliana


Alignment Length:508 Identity:108/508 - (21%)
Similarity:181/508 - (35%) Gaps:166/508 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVVTILKPPSLHKDINHI-LVPMEEDILQAFNSVV---------GG 89
            |:...:.:|..|||:.|.   :|.|.|....|.:..: |.|   |.: .|.::.         |.
plant    17 HMTAFLHLANKLAEKDHK---ITFLLPKKARKQLESLNLFP---DCI-VFQTLTIPSVDGLPDGA 74

  Fly    90 MTKTD-----NSNAYVSMFRSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFDLVMVGYFMNCYQ 149
            .|.:|     .|....:|.|:..|:.|..|.                  .|.||:...:.....:
plant    75 ETTSDIPISLGSFLASAMDRTRIQVKEAVSV------------------GKPDLIFFDFAHWIPE 121

  Fly   150 LALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGF--------GHRV--L 204
            :|..:.:|....:.:|          .....:|:|||.|....|..|.|:        ||..  |
plant   122 IAREYGVKSVNFITIS----------AACVAISFVPGRSQDDLGSTPPGYPSSKVLLRGHETNSL 176

  Fly   205 NLLG-------SMAQRLFMFIIELRNA-----RIYREIYGDDPTLPSYEDLHKNISLIFFASHGI 257
            :.|.       |..:|:   :|.|:|.     |..:|:.|      .:.|..:|    .|....:
plant   177 SFLSYPFGDGTSFYERI---MIGLKNCDVISIRTCQEMEG------KFCDFIEN----QFQRKVL 228

  Fly   258 SEGPIRPNVPAVIEIGGIQVKEQPERLPQNMEQFLSE-APNGAILLSLGSN--LKEDHLK----- 314
            ..||:.|.            .:..:.|.....|:||: .|...|..:|||.  |::|..:     
plant   229 LTGPMLPE------------PDNSKPLEDQWRQWLSKFDPGSVIYCALGSQIILEKDQFQELCLG 281

  Fly   315 -----------------SSTVQKMFNVLSK-LQQKVIWKWDDLDNIPGESENILYSKWVPQVDVL 361
                             |||:|:   .|.| .:::|            ::..:::..||.|..:|
plant   282 MELTGLPFLVAVKPPKGSSTIQE---ALPKGFEERV------------KARGVVWGGWVQQPLIL 331

  Fly   362 AHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMHGFGIKQSILTLEE------ 420
            |||:|..|::|.|.|.:.||..:...::.:|..|:|..|..:|...   :|.|:....|      
plant   332 AHPSIGCFVSHCGFGSMWEALVNDCQIVFIPHLGEQILNTRLMSEE---LKVSVEVKREETGWFS 393

  Fly   421 -DSFLQGIREVLDNPKYATAVKSFSTLYRDRPLS--PRETLIYWVEYVIRYHG 470
             :|....:|.|:|               ||..|.  .|...:.|.|.::| ||
plant   394 KESLSGAVRSVMD---------------RDSELGNWARRNHVKWKESLLR-HG 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 108/508 (21%)
egt 13..483 CDD:223071 108/508 (21%)
AT5G54010NP_200212.1 Glycosyltransferase_GTB_type 1..451 CDD:299143 108/508 (21%)
MGT 8..409 CDD:273616 100/484 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.