DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT5G38040

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_198620.1 Gene:AT5G38040 / 833784 AraportID:AT5G38040 Length:449 Species:Arabidopsis thaliana


Alignment Length:414 Identity:79/414 - (19%)
Similarity:148/414 - (35%) Gaps:102/414 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVV----TILKPPSLHKDINHILVPMEEDILQAFNSVVGGMTKTDN 95
            |:...:.:|:.|..:|.::|||    ..|.|.:...|...:.:|             ..:..:|.
plant    21 HITPMIQLAKALHSKGFSITVVQTKFNYLNPSNDLSDFQFVTIP-------------ENLPVSDL 72

  Fly    96 SNAYVSMFRSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFDLVMVGYFMNCYQLALAH-KLKVP 159
            .|.....| .::..:|.:....|::.|.||.:     :.:...|:...||...::|:.. ||: .
plant    73 KNLGPGRF-LIKLANECYVSFKDLLGQLLVNE-----EEEIACVIYDEFMYFVEVAVKEFKLR-N 130

  Fly   160 LVVALSNPPSFLGYLL---------------GNPWEVSYVP----------------GMSVSIKG 193
            ::::.::..:|:...:               |...||..||                .:..|::.
plant   131 VILSTTSATAFVCRFVMCELYAKDGLAQLKEGGEREVELVPELYPIRYKDLPSSVFASVESSVEL 195

  Fly   194 GKPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDP-----TLPSYEDLHKNISLIFFA 253
            .|...:.....:::.:..:.|.|..:|.....:...:|...|     :.|....|.:|.|.|.:.
plant   196 FKNTCYKGTASSVIINTVRCLEMSSLEWLQQELEIPVYSIGPLHMVVSAPPTSLLEENESCIEWL 260

  Fly   254 SHGISEGPIRPNVPAVIEIGGIQVKEQPERLP------QNMEQFLSEAPNGAILLSLGSNLKEDH 312
            :..      :|:....|.:|...:.|..|.|.      .:.:.||.....|:|   .||.:.|:.
plant   261 NKQ------KPSSVIYISLGSFTLMETKEMLEMAYGFVSSNQHFLWVIRPGSI---CGSEISEEE 316

  Fly   313 LKSSTVQKMFNVLSKLQQKVIWKWDDLDNIPGESENILYSKWVPQVDVLAHPNITLFITHAGKGG 377
            |              |::.||            ::.....||.||..||||..:..|.:|.|...
plant   317 L--------------LKKMVI------------TDRGYIVKWAPQKQVLAHSAVGAFWSHCGWNS 355

  Fly   378 LTEAQYHGKPMLALPVFGDQPSNA 401
            ..|:...|.|::..|...||..||
plant   356 TLESLGEGVPLICRPFTTDQKGNA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 79/414 (19%)
egt 13..483 CDD:223071 79/414 (19%)
AT5G38040NP_198620.1 Glycosyltransferase_GTB-type 1..446 CDD:415824 79/414 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.