DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT5G38010

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_198617.1 Gene:AT5G38010 / 833780 AraportID:AT5G38010 Length:453 Species:Arabidopsis thaliana


Alignment Length:444 Identity:97/444 - (21%)
Similarity:159/444 - (35%) Gaps:123/444 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QIVVLIAGAHGANILGLFTSLSPSHLVIQMSMARILAERGHNVTVV----TILKPPSLHKDINHI 71
            :||::.|.|.|             |:...|.:||.|..:|.::||.    ..|||.....|...|
plant    10 RIVLIPAPAQG-------------HISPMMQLARALHLKGFSITVAQTKFNYLKPSKDLADFQFI 61

  Fly    72 LVPMEEDILQAFNSVVGGMTKTDNSNAYVSMFRSVRQLSETFSK-MGDVMKQPLVKDLYEHPDNK 135
            .:|   :.|.|        :...|......:.:..::...:|.: :|.::.|   |.|.  |:.:
plant    62 TIP---ESLPA--------SDLKNLGPVWFLLKLNKECEFSFKECLGQLLLQ---KQLI--PEEE 110

  Fly   136 FDLVMVGYFMNCYQLALAHKLKVPLVV-ALSNPPSFLGYLLGNPWEVSYVPGMSVSIK-----GG 194
            ...|:...|| .:..|.|.:..:|.|: :..|..:|              ...|...|     |.
plant   111 IACVIYDEFM-YFAEAAAKEFNLPKVIFSTENATAF--------------ACRSAMCKLYAKDGL 160

  Fly   195 KPL--GFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFAS--H 255
            .||  |.|..         :.|...:..||        |.|.|| .::..:..::. :|.:|  .
plant   161 APLKEGCGRE---------EELVPKLHPLR--------YKDLPT-SAFAPVEASVE-VFKSSCDK 206

  Fly   256 GISEGPIRPNVPAVIEIGGIQVKEQPERLP--------------------QN---MEQFLSEAPN 297
            |.:...| .|....:||..::..:|..::|                    :|   ::....:.|:
plant   207 GTASAMI-INTVRCLEISSLEWLQQELKIPIYPIGPLHMVSSAPPTSLLDENESCIDWLNKQKPS 270

  Fly   298 GAILLSLGSNLKEDHLKSSTVQKMFNVLSKLQQKVIW-------KWDDLDN--------IPGESE 347
            ..|.:||||...   |::..|.:|.:.|....|..:|       ...:|.|        ||....
plant   271 SVIYISLGSFTL---LETKEVLEMASGLVSSNQHFLWVIRPGSILGSELTNEELLSMMEIPDRGY 332

  Fly   348 NILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNA 401
            .:   ||.||..||||..:..|.:|.|.....|:...|.||:..|...||..||
plant   333 IV---KWAPQKQVLAHSAVGAFWSHCGWNSTLESMGEGVPMICRPFTTDQKVNA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 97/443 (22%)
egt 13..483 CDD:223071 96/442 (22%)
AT5G38010NP_198617.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 97/444 (22%)
YjiC 8..433 CDD:224732 97/444 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.