DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT72E3

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_198003.1 Gene:UGT72E3 / 832700 AraportID:AT5G26310 Length:481 Species:Arabidopsis thaliana


Alignment Length:507 Identity:103/507 - (20%)
Similarity:184/507 - (36%) Gaps:161/507 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IAGAHGANILGLFTSLSPSHLVIQMSMA-RILAERGHNVTVVTILKPPSLHKDI----NHILVPM 75
            |...|.|    :|:|....|::..:.:| |:.|..|.:|||..      |..|.    :.:|...
plant     3 ITKPHAA----MFSSPGMGHVLPVIELAKRLSANHGFHVTVFV------LETDAASVQSKLLNST 57

  Fly    76 EEDILQAFNSVVGGMTKTDNSNAYVSMFRSVRQLSETFSKMGDVMKQ--PLVKD----LYEHPDN 134
            ..||:...:..:.|:.   :.||:|            .:|:|.:|::  |.::.    ::::|  
plant    58 GVDIVNLPSPDISGLV---DPNAHV------------VTKIGVIMREAVPTLRSKIVAMHQNP-- 105

  Fly   135 KFDLVMVGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYLLGNPW------EVSYVPGMSVSIKG 193
              ..:::..| ....|.||.:|.:...|.:::...:||..:..|.      |...|....::|.|
plant   106 --TALIIDLF-GTDALCLAAELNMLTYVFIASNARYLGVSIYYPTLDEVIKEEHTVQRKPLTIPG 167

  Fly   194 GKPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFASHGI- 257
            .:|:.|.                   ::.:|.:.       |..|.|.||.:: .|.:..:.|| 
plant   168 CEPVRFE-------------------DIMDAYLV-------PDEPVYHDLVRH-CLAYPKADGIL 205

  Fly   258 ------------------------SEGPIRPNVPAVIEIGGIQVKEQPERLPQNMEQFLSEAPNG 298
                                    :..|:.|       :|.:....|.......:..:|::.||.
plant   206 VNTWEEMEPKSLKSLQDPKLLGRVARVPVYP-------VGPLCRPIQSSTTDHPVFDWLNKQPNE 263

  Fly   299 AIL-LSLGSNLKEDHLKSSTVQKMFNV---LSKLQQKVIW---------KWDDL---------DN 341
            ::| :|.||.      .|.|.|::..:   |.:.||:.||         ...|.         ||
plant   264 SVLYISFGSG------GSLTAQQLTELAWGLEESQQRFIWVVRPPVDGSSCSDYFSAKGGVTKDN 322

  Fly   342 IPGE----------SENILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGD 396
            .|..          ....:...|.||.::|||..:..|:||.|.....|:...|.||:|.|:|.:
plant   323 TPEYLPEGFVTRTCDRGFMIPSWAPQAEILAHQAVGGFLTHCGWSSTLESVLCGVPMIAWPLFAE 387

  Fly   397 QPSNADVMVMHGFGIKQSILTLEEDSFLQGIREVLDNPKYATAVKSFSTLYR 448
            |..||            ::|:.|     .||...:|:||.|.:......:.|
plant   388 QNMNA------------ALLSDE-----LGISVRVDDPKEAISRSKIEAMVR 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 103/507 (20%)
egt 13..483 CDD:223071 103/507 (20%)
UGT72E3NP_198003.1 PLN02992 1..481 CDD:178572 103/507 (20%)
YjiC 5..442 CDD:224732 102/505 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.