DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT5G03490

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_195969.1 Gene:AT5G03490 / 831823 AraportID:AT5G03490 Length:465 Species:Arabidopsis thaliana


Alignment Length:447 Identity:94/447 - (21%)
Similarity:172/447 - (38%) Gaps:108/447 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVLIAGAHGANI----LGLFTSLSPSHLVIQMSMARILAERGHNVTVV------TILKP-PSLH- 65
            |:|:.|....|.    :.:|...:..||:..:.:...|..||.||:|:      |.|.| .|.| 
plant     4 VLLLPGTKSENSKPPHIVVFPFPAQGHLLPLLDLTHQLCLRGFNVSVIVTPGNLTYLSPLLSAHP 68

  Fly    66 KDINHILVPMEEDILQAFNSVVGGM--TKTDNSNAYVSMFRSVRQLSETFSKMGDVMKQPLVKDL 128
            ..:..::.|     .....|:..|:  .|...::..:.:..|:|||           ::|::...
plant    69 SSVTSVVFP-----FPPHPSLSPGVENVKDVGNSGNLPIMASLRQL-----------REPIINWF 117

  Fly   129 YEHPDNKFDLVMVGYFMN-----CYQLALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMS 188
            ..||:....|:. .:|:.     |.|:.:               |.|..:      .:|:   ..
plant   118 QSHPNPPIALIS-DFFLGWTHDLCNQIGI---------------PRFAFF------SISF---FL 157

  Fly   189 VSIKGGKPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYRE----------IYGDDPTLPSYEDL 243
            ||:     |.|....::|:.|...   :.:::|..|.|::|          :....|.|.|.:|.
plant   158 VSV-----LQFCFENIDLIKSTDP---IHLLDLPRAPIFKEEHLPSIVRRSLQTPSPDLESIKDF 214

  Fly   244 HKNI---SLIFFASHGISEGPI-----RPNVPAVIEIG-----GIQVKEQPERLPQNMEQFLSEA 295
            ..|:   ..:|.:|..:.:..:     |.....|..||     |..:|.....:..::..:|..:
plant   215 SMNLLSYGSVFNSSEILEDDYLQYVKQRMGHDRVYVIGPLCSIGSGLKSNSGSVDPSLLSWLDGS 279

  Fly   296 PNGAIL-LSLGSN--LKEDHLKSSTVQKMFNVLSKLQQKVIW--KWDDL-----DNIPGESENIL 350
            |||::| :..||.  |.:|...:..:.     |.|...:.:|  |.|.:     |.:.|  ..::
plant   280 PNGSVLYVCFGSQKALTKDQCDALALG-----LEKSMTRFVWVVKKDPIPDGFEDRVSG--RGLV 337

  Fly   351 YSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMH 407
            ...||.|:.||.|..:..|::|.|...:.|....|..:|..|:..||..||.::|.|
plant   338 VRGWVSQLAVLRHVAVGGFLSHCGWNSVLEGITSGAVILGWPMEADQFVNARLLVEH 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 94/447 (21%)
egt 13..483 CDD:223071 94/447 (21%)
AT5G03490NP_195969.1 Glycosyltransferase_GTB_type 19..460 CDD:299143 90/432 (21%)
YjiC 19..447 CDD:224732 90/432 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.