DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:100 Identity:30/100 - (30%)
Similarity:47/100 - (47%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 WVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNA-DVMVMHGFGIKQSILT 417
            |.|||::|.|..:.:|::|.|...:.|:...|.||:..|:|||...|| .|..:...|:..|...
plant   337 WAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHAINARSVEAVWEIGVTISSGV 401

  Fly   418 LEEDSFLQGIREVL---DNPKYATAVKSFSTLYRD 449
            ..:|.|.:.:..||   |..|.....|....|.::
plant   402 FTKDGFEESLDRVLVQDDGKKMKVNAKKLEELAQE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 30/99 (30%)
egt 13..483 CDD:223071 30/99 (30%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 30/99 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.