DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT5G12890

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_196793.1 Gene:AT5G12890 / 831129 AraportID:AT5G12890 Length:488 Species:Arabidopsis thaliana


Alignment Length:491 Identity:89/491 - (18%)
Similarity:179/491 - (36%) Gaps:131/491 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LFTSLSPSHLV----IQMSMARILAERGHNVTVVTILKPPSLHKDINHILVPMEEDIL--QAFNS 85
            :|..:...|::    :.:.:.:|:.....|.|.::::..||....|...|.|.....|  ..|||
plant    13 MFPFMGQGHIIPFVALALRLEKIMIMNRANKTTISMINTPSNIPKIRSNLPPESSISLIELPFNS 77

  Fly    86 VVGGMTKTDNSN-------AYVSMFRSVRQLSETFSK-MGDVMKQPLVKDLYEHPDNKFDLVMVG 142
            ...|:.. |..|       ..:|:..:.|.|.|.|.. |..::|:          :.:..::::|
plant    78 SDHGLPH-DGENFDSLPYSLVISLLEASRSLREPFRDFMTKILKE----------EGQSSVIVIG 131

  Fly   143 YFMNCYQLALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGFGHRVLNLL 207
            .|                         |||: :|...:...|..:..|..|...||....:...|
plant   132 DF-------------------------FLGW-IGKVCKEVGVYSVIFSASGAFGLGCYRSIWLNL 170

  Fly   208 GSMAQRLFMFII-------ELRNARIYREIYGDDPT----------LPSYED----LHKNISLI- 250
            .....:...|::       |:...::...:...|.|          :|.:.|    |...::.| 
plant   171 PHKETKQDQFLLDDFPEAGEIEKTQLNSFMLEADGTDDWSVFMKKIIPGWSDFDGFLFNTVAEID 235

  Fly   251 ------FFASHGISEGPIRPNVPAVIEIGGIQVKEQPER------LPQNMEQFLSEAPNGAIL-L 302
                  |....|:...|:.|            |.:.|::      ..:.::.:|...|:.::: :
plant   236 QMGLSYFRRITGVPVWPVGP------------VLKSPDKKVGSRSTEEAVKSWLDSKPDHSVVYV 288

  Fly   303 SLGS--NLKEDHLKSSTVQKMFNVLSKLQQKVIW------------KWDDLDNIP-GESENI--- 349
            ..||  ::.:.|:     .::...|...::..||            ::|....:| |..|.|   
plant   289 CFGSMNSILQTHM-----LELAMALESSEKNFIWVVRPPIGVEVKSEFDVKGYLPEGFEERITRS 348

  Fly   350 ----LYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMHGFG 410
                |..||.||||:|:|....:|::|.|...:.|:..||.|:|..|:..:|..|:.:|..| .|
plant   349 ERGLLVKKWAPQVDILSHKATCVFLSHCGWNSILESLSHGVPLLGWPMAAEQFFNSILMEKH-IG 412

  Fly   411 IKQSI-----LTLEEDSFLQGIREVLDNPKYATAVK 441
            :...:     ..::.|..:..|:.|::..:....::
plant   413 VSVEVARGKRCEIKCDDIVSKIKLVMEETEVGKEIR 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 89/491 (18%)
egt 13..483 CDD:223071 89/491 (18%)
AT5G12890NP_196793.1 Glycosyltransferase_GTB-type 2..478 CDD:415824 89/491 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.