DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT5G05880

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_196207.1 Gene:AT5G05880 / 830473 AraportID:AT5G05880 Length:451 Species:Arabidopsis thaliana


Alignment Length:453 Identity:97/453 - (21%)
Similarity:162/453 - (35%) Gaps:129/453 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MSMARILAERGHNVTVV-TILKPPSLHKDINHILVPMEEDILQAFNSVVGGMTKTD--------- 94
            :.:|:||..||.::||: |....|   |..:|.|.        .|..:..|:::|:         
plant    24 IQLAKILHSRGFSITVIHTCFNAP---KASSHPLF--------TFIQIQDGLSETETRTRDVKLL 77

  Fly    95 ----NSNAYVSMFRSVRQLSET-----------FSKMGDVMKQPLVKDLYEHPDN----KFDLVM 140
                |.|....:...:|:|.::           .:..|.:..|.|.|.|     |    .|:...
plant    78 ITLLNQNCESPVRECLRKLLQSAKEEKQRISCLINDSGWIFTQHLAKSL-----NLMRLAFNTYK 137

  Fly   141 VGYFMNCYQL-ALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGM----------SVSIKGG 194
            :.:|.:.:.| .|..::.:||..:..:.|            |...|.:          :.|::|.
plant   138 ISFFRSHFVLPQLRREMFLPLQDSEQDDP------------VEKFPPLRKKDLLRILEADSVQGD 190

  Fly   195 KPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFASHGISE 259
               .:...:|....:.:..:||...||          ..|....|.||....|..|         
plant   191 ---SYSDMILEKTKASSGLIFMSCEEL----------DQDSLSQSREDFKVPIFAI--------- 233

  Fly   260 GPIRPNVPAVIEIGGIQVKEQPERLPQNMEQFLSEAPNGAILLSLGSNLKEDHLKSSTVQKMFNV 324
            ||...:.||    ....:....|.....:::   :.....|.:|:||.:.   :..:.:.::...
plant   234 GPSHSHFPA----SSSSLFTPDETCIPWLDR---QEDKSVIYVSIGSLVT---INETELMEIAWG 288

  Fly   325 LSKLQQKVIW----------KWDDLDNIP-------GESENILYSKWVPQVDVLAHPNITLFITH 372
            ||...|..:|          :|  ::.||       .|...|:  ||.||.:||.|..|..|:||
plant   289 LSNSDQPFLWVVRVGSVNGTEW--IEAIPEYFIKRLNEKGKIV--KWAPQQEVLKHRAIGGFLTH 349

  Fly   373 AGKGGLTEAQYHGKPMLALPVFGDQPSNA----DVMVMHGFGIKQSILTLEEDSFLQGIREVL 431
            .|.....|:...|.||:.||...||..||    ||. |.|..::..|   |.|...:.||.:|
plant   350 NGWNSTVESVCEGVPMICLPFRWDQLLNARFVSDVW-MVGIHLEGRI---ERDEIERAIRRLL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 97/453 (21%)
egt 13..483 CDD:223071 97/453 (21%)
AT5G05880NP_196207.1 Glycosyltransferase_GTB-type 2..451 CDD:385653 97/453 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.