DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT76C1

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_196206.1 Gene:UGT76C1 / 830472 AraportID:AT5G05870 Length:464 Species:Arabidopsis thaliana


Alignment Length:506 Identity:105/506 - (20%)
Similarity:183/506 - (36%) Gaps:157/506 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MSMARILAERGHNVTVVTILKPPSLHKDINHILVPMEED-ILQAFNSVVGGMTKTD--------- 94
            :.:|:||..||.::|::        |...|   .|...| .|..|..:..|::::.         
plant    24 LQLAKILYSRGFSITII--------HTRFN---APKSSDHPLFTFLQIRDGLSESQTQSRDLLLQ 77

  Fly    95 ----NSNAYVSMFRSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFDLVM--VGYFMNCYQLALA 153
                |:|..:.....:.:|.:..|..|.             .|.|...|:  .|:   .:..::|
plant    78 LTLLNNNCQIPFRECLAKLIKPSSDSGT-------------EDRKISCVIDDSGW---VFTQSVA 126

  Fly   154 HKLKVPLVVALSNPPS-FLGYLLGNPWEVSYVPGMSVSIKGGKPLGFGHR--------------V 203
            ....:|..|..:...| |||:.|        ||  .:..:|..|:.....              :
plant   127 ESFNLPRFVLCAYKFSFFLGHFL--------VP--QIRREGFLPVPDSEADDLVPEFPPLRKKDL 181

  Fly   204 LNLLGSMAQR--LFMFIIELRNARIYREIYGDDPTLP-------SYEDL-HKNISLIFFASHGIS 258
            ..::|:.||.  |..:::::.           |.|.|       |.::| |.:::    .|:.:.
plant   182 SRIMGTSAQSKPLDAYLLKIL-----------DATKPASGIIVMSCKELDHDSLA----ESNKVF 231

  Fly   259 EGPIRPNVPAVIEIGGIQVKEQPERLPQNMEQFLSEAP-------NGAILLSLGSNLKEDHLKSS 316
            ..||.|       ||...:.:.|......:|...|..|       ...:.:||||...   |..|
plant   232 SIPIFP-------IGPFHIHDVPASSSSLLEPDQSCIPWLDMRETRSVVYVSLGSIAS---LNES 286

  Fly   317 TVQKMFNVLSKLQQKVIW----------KWDD------LDNIPGESENILYSKWVPQVDVLAHPN 365
            ...::...|....|..:|          .|.:      ::::.|:.:.:   :|.||:|||||..
plant   287 DFLEIACGLRNTNQSFLWVVRPGSVHGRDWIESLPSGFMESLDGKGKIV---RWAPQLDVLAHRA 348

  Fly   366 ITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMV------MHGFG------IKQSILTL 418
            ...|:||.|.....|:...|.||:.||...||..||..:.      :|..|      |:::::.|
plant   349 TGGFLTHNGWNSTLESICEGVPMICLPCKWDQFVNARFISEVWRVGIHLEGRIERREIERAVIRL 413

  Fly   419 EEDSFLQGIR---EVLDNPKYATAVKSFSTLYR------DR------PLSP 454
            ..:|..:.||   :|| ..:...:||...:.||      ||      ||.|
plant   414 MVESKGEEIRGRIKVL-RDEVRRSVKQGGSSYRSLDELVDRISIIIEPLVP 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 105/506 (21%)
egt 13..483 CDD:223071 105/506 (21%)
UGT76C1NP_196206.1 Glycosyltransferase_GTB_type 2..451 CDD:299143 100/492 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.