DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT76C2

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_196205.1 Gene:UGT76C2 / 830471 AraportID:AT5G05860 Length:450 Species:Arabidopsis thaliana


Alignment Length:446 Identity:96/446 - (21%)
Similarity:163/446 - (36%) Gaps:109/446 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MSMARILAERGHNVTVV-TILKPPSLHKDINHILVPMEEDILQAFNSVVGGMTKTDNSNAYVSMF 103
            :.:|.||..||.::||: |....|   |..:|.|.        .|..:..|:::|:..:..:|:.
plant    25 LQLANILHVRGFSITVIHTRFNAP---KASSHPLF--------TFLQIPDGLSETEIQDGVMSLL 78

  Fly   104 RSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFDLVMVGYFMNC---YQLALAHKLKVPLVVALS 165
            ..:...:|  |...|.::    |.|.|..:::....::.   :|   :..:::..||:|.:|..:
plant    79 AQINLNAE--SPFRDCLR----KVLLESKESERVTCLID---DCGWLFTQSVSESLKLPRLVLCT 134

  Fly   166 NPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGFGHR--------------VLNLLGSMAQRLFM 216
            ...:|..         :|.....:..||..|:.....              :..:.|...::|..
plant   135 FKATFFN---------AYPSLPLIRTKGYLPVSESEAEDSVPEFPPLQKRDLSKVFGEFGEKLDP 190

  Fly   217 FIIELRNARIYREIYGDDPTLPSYEDLHKN---ISLIFFASHGISEGPIRPNVPAVIEIGGIQVK 278
            |:    :|.:...|........|.|:|.|:   :|...|.....:.||......|          
plant   191 FL----HAVVETTIRSSGLIYMSCEELEKDSLTLSNEIFKVPVFAIGPFHSYFSA---------- 241

  Fly   279 EQPERLPQNMEQFL---SEAPNGAILLSLGS--NLKEDHLKSSTVQKMFNVLSKLQQKVIW---- 334
            .......|:....|   .:.....|.:||||  |:.|.........     ||..:|..:|    
plant   242 SSSSLFTQDETCILWLDDQEDKSVIYVSLGSVVNITETEFLEIACG-----LSNSKQPFLWVVRP 301

  Fly   335 ------KWDDLDNIPGESENILYS--------KWVPQVDVLAHPNITLFITHAGKGGLTEAQYHG 385
                  ||     |...||.::.|        ||.||.:||||.....|:||.|.....|:...|
plant   302 GSVLGAKW-----IEPLSEGLVSSLEEKGKIVKWAPQQEVLAHRATGGFLTHNGWNSTLESICEG 361

  Fly   386 KPMLALPVFGDQPSN----ADV--MVMHGFG------IKQSILTLEEDSFLQGIRE 429
            .||:.||...||..|    :|:  :.:|..|      |::::..|.|:|....|||
plant   362 VPMICLPGGWDQMLNSRFVSDIWKIGIHLEGRIEKKEIEKAVRVLMEESEGNKIRE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 96/446 (22%)
egt 13..483 CDD:223071 96/446 (22%)
UGT76C2NP_196205.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 96/446 (22%)
YjiC 9..429 CDD:224732 96/446 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.