DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and GT72B1

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_192016.1 Gene:GT72B1 / 827912 AraportID:AT4G01070 Length:480 Species:Arabidopsis thaliana


Alignment Length:429 Identity:88/429 - (20%)
Similarity:165/429 - (38%) Gaps:96/429 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LGLFTSLSPSHLVIQMSMARILAERGHNVTVVTILK---PP---------SLHKDINHILVPMEE 77
            :.:..|....||:..:..|:.|... |.:||..::.   ||         ||...|:.:.:| ..
plant     9 VAIIPSPGMGHLIPLVEFAKRLVHL-HGLTVTFVIAGEGPPSKAQRTVLDSLPSSISSVFLP-PV 71

  Fly    78 DILQAFNSVVGGMTKTDNSNAYVSMFRSVRQLSETFSKM--GDVMKQPLVKDLYEHPDNKFDLVM 140
            |:....:|     |:.: |...:::.||..:|.:.|...  |..:...||.||:  ..:.||   
plant    72 DLTDLSSS-----TRIE-SRISLTVTRSNPELRKVFDSFVEGGRLPTALVVDLF--GTDAFD--- 125

  Fly   141 VGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMSVSIK------------- 192
                       :|.:..||..:......:.|.:.|       ::|.:..::.             
plant   126 -----------VAVEFHVPPYIFYPTTANVLSFFL-------HLPKLDETVSCEFRELTEPLMLP 172

  Fly   193 GGKPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFASHGI 257
            |..|:. |...|:.........:.::  |.|.:.|:|..|  ..:.::.:|..| ::......|:
plant   173 GCVPVA-GKDFLDPAQDRKDDAYKWL--LHNTKRYKEAEG--ILVNTFFELEPN-AIKALQEPGL 231

  Fly   258 SEGPIRPNVPAVIEIGGIQVKEQPERLPQNMEQFLSEAPNGAIL-LSLGSNLKEDHLKSSTVQKM 321
            .:.|:.| |..::.||..:.|:..|   ....::|...|.|::| :|.||.   ..|....:.::
plant   232 DKPPVYP-VGPLVNIGKQEAKQTEE---SECLKWLDNQPLGSVLYVSFGSG---GTLTCEQLNEL 289

  Fly   322 FNVLSKLQQKVIW------------------KWDDLDNIP------GESENILYSKWVPQVDVLA 362
            ...|:..:|:.:|                  :.|.|..:|      .:....:...|.||..|||
plant   290 ALGLADSEQRFLWVIRSPSGIANSSYFDSHSQTDPLTFLPPGFLERTKKRGFVIPFWAPQAQVLA 354

  Fly   363 HPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNA 401
            ||:...|:||.|.....|:...|.|::|.|::.:|..||
plant   355 HPSTGGFLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNA 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 88/429 (21%)
egt 13..483 CDD:223071 88/429 (21%)
GT72B1NP_192016.1 Glycosyltransferase_GTB_type 7..462 CDD:299143 88/429 (21%)
MGT 15..454 CDD:273616 87/423 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.