DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT71B5

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001328018.1 Gene:UGT71B5 / 827194 AraportID:AT4G15280 Length:510 Species:Arabidopsis thaliana


Alignment Length:434 Identity:91/434 - (20%)
Similarity:156/434 - (35%) Gaps:131/434 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 INHILVPMEEDILQAFNSVVGGMTKTDNSNAYVSMFRSVRQLSETFSKMGDVMKQPLVKDLYEHP 132
            |..|::|...|              ..:::|.::...::.|......:...|.|||...|....|
plant    67 ITIIIIPSRFD--------------AGDASACIASLTTLSQDDRLHYESISVAKQPPTSDPDPVP 117

  Fly   133 DNKF---------DLV----------MVGYFMNCY---QLALAHKLKVPLVVALSNPPSFLGYL- 174
            ...:         |.|          :.|:.::.:   .:.:|::..||..:..::..:|||.: 
plant   118 AQVYIEKQKTKVRDAVAARIVDPTRKLAGFVVDMFCSSMIDVANEFGVPCYMVYTSNATFLGTML 182

  Fly   175 ---------------------------LGNPWEVSYVPGMSVSIKGGKPLGFGHRVLNLLGSMAQ 212
                                       |..|:.|..:|.:..| |...||           |:||
plant   183 HVQQMYDQKKYDVSELENSVTELEFPSLTRPYPVKCLPHILTS-KEWLPL-----------SLAQ 235

  Fly   213 RLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFASHGISEGPIRPNVPAV-IEIGGIQ 276
                       ||.:|::.|......:..:.|   :|..|..:|.....:.|..|.: :|.|...
plant   236 -----------ARCFRKMKGILVNTVAELEPH---ALKMFNINGDDLPQVYPVGPVLHLENGNDD 286

  Fly   277 VKEQPERLPQNMEQFLSEAPN-GAILLSLGS--NLKEDHLKSSTVQKMFNVLSKLQQKVIW---- 334
            .::|.|.|     ::|.|.|: ..:.|..||  ...|:..:.:.|     .|.:..|:.:|    
plant   287 DEKQSEIL-----RWLDEQPSKSVVFLCFGSLGGFTEEQTRETAV-----ALDRSGQRFLWCLRH 341

  Fly   335 -----KWD---DLDNI-----PGESENIL----YSKWVPQVDVLAHPNITLFITHAGKGGLTEAQ 382
                 |.|   |..|:     .|..|..|    ...|.|||.||..|.|..|:||.|...:.|:.
plant   342 ASPNIKTDRPRDYTNLEEVLPEGFLERTLDRGKVIGWAPQVAVLEKPAIGGFVTHCGWNSILESL 406

  Fly   383 YHGKPMLALPVFGDQPSNADVMVMHGFGIKQSILTLEEDSFLQG 426
            :.|.||:..|::.:|..||..||      ::..|.:|...:|:|
plant   407 WFGVPMVTWPLYAEQKVNAFEMV------EELGLAVEIRKYLKG 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 91/434 (21%)
egt 13..483 CDD:223071 91/434 (21%)
UGT71B5NP_001328018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.