DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT4G15260

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_193261.2 Gene:AT4G15260 / 827192 AraportID:AT4G15260 Length:359 Species:Arabidopsis thaliana


Alignment Length:278 Identity:62/278 - (22%)
Similarity:107/278 - (38%) Gaps:89/278 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 LIFFASHGIS----EGPIRPNVPAVIEIGGIQV---KEQPERLP---------------QNME-- 289
            |.|||:.|.|    :| |..|..|.:|...:::   .:.|:..|               :.:|  
plant    79 LPFFAAQGRSFRKMKG-ILVNTVAELEPHALKMFNNVDLPQAYPVGPVLHLDNGDDDDEKRLEVL 142

  Fly   290 QFLSEAPNGAIL-LSLGS--NLKEDHLKSSTVQKMFNVLSKLQQKVIWKWDDLD-NI----PGES 346
            ::|.:.|..::| |..||  ...|:..:...|     .|::...:.:|...... ||    ||:.
plant   143 RWLDDQPPKSVLFLCFGSMGGFTEEQTREVAV-----ALNRSGHRFLWSLRRASPNIMMERPGDY 202

  Fly   347 ENI----------------LYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFG 395
            :|:                ....|.|||.||..|.|..|:||.|...:.|:.:.|.||:..|::.
plant   203 KNLEEVLPDGFLERTLDRGKVIGWAPQVAVLEKPAIGGFVTHCGWNSMLESLWFGVPMVTWPLYA 267

  Fly   396 DQPSNADVMVMH-GFGI--------------KQSILT-----------LEEDSFLQG-IRE---- 429
            :|..||..||.. |..:              :..|:|           :|:||.::. ::|    
plant   268 EQKVNAFEMVEELGLAVEIRKCISGDLLLIGEMEIVTAEDIERAIRCVMEQDSDVRSRVKEMAEK 332

  Fly   430 ----VLDNPKYATAVKSF 443
                ::|.....||::.|
plant   333 CHVALMDGGSSKTALQKF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 62/278 (22%)
egt 13..483 CDD:223071 62/278 (22%)
AT4G15260NP_193261.2 Glycosyltransferase_GTB_type <1..359 CDD:299143 62/278 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.