DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT4G14090

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_193146.1 Gene:AT4G14090 / 827046 AraportID:AT4G14090 Length:456 Species:Arabidopsis thaliana


Alignment Length:243 Identity:56/243 - (23%)
Similarity:85/243 - (34%) Gaps:92/243 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 PIR-PNVPAVIEIGGIQVKEQPER--------LPQNMEQFLSEAPNGAILLSLGSNLKEDHLKSS 316
            ||: |.:| :|..|.:....||.:        |.:::|...:|: |..||::..|.|:.|.|.|.
plant   167 PIKLPKLP-LITTGDLPSFLQPSKALPSALVTLREHIEALETES-NPKILVNTFSALEHDALTSV 229

  Fly   317 TVQKMFNV-------------------------LSKLQQKVIW-----KWDDL------------ 339
            ...||..:                         .|||::.||:     ..|||            
plant   230 EKLKMIPIGPLVSSSEGKTDLFKSSDEDYTKWLDSKLERSVIYISLGTHADDLPEKHMEALTHGV 294

  Fly   340 ------------DNIPGE------------SENILYSKWVPQVDVLAHPNITLFITHAGKGGLTE 380
                        :..|.|            |:..|...|..|..||||..:..|:||.|.....|
plant   295 LATNRPFLWIVREKNPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHCAVGCFVTHCGWNSTLE 359

  Fly   381 AQYHGKPMLALPVFGDQPSNADVMVMHGFGIKQSILTLEEDSFLQGIR 428
            :...|.|::|.|.|.||.:.|               .|.||::..|::
plant   360 SLESGVPVVAFPQFADQCTTA---------------KLVEDTWRIGVK 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 56/243 (23%)
egt 13..483 CDD:223071 56/243 (23%)
AT4G14090NP_193146.1 YjiC 11..445 CDD:224732 56/243 (23%)
Glycosyltransferase_GTB_type 12..454 CDD:299143 56/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.