Sequence 1: | NP_525008.2 | Gene: | Ugt37B1 / 53584 | FlyBaseID: | FBgn0026755 | Length: | 537 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_193146.1 | Gene: | AT4G14090 / 827046 | AraportID: | AT4G14090 | Length: | 456 | Species: | Arabidopsis thaliana |
Alignment Length: | 243 | Identity: | 56/243 - (23%) |
---|---|---|---|
Similarity: | 85/243 - (34%) | Gaps: | 92/243 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 261 PIR-PNVPAVIEIGGIQVKEQPER--------LPQNMEQFLSEAPNGAILLSLGSNLKEDHLKSS 316
Fly 317 TVQKMFNV-------------------------LSKLQQKVIW-----KWDDL------------ 339
Fly 340 ------------DNIPGE------------SENILYSKWVPQVDVLAHPNITLFITHAGKGGLTE 380
Fly 381 AQYHGKPMLALPVFGDQPSNADVMVMHGFGIKQSILTLEEDSFLQGIR 428 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ugt37B1 | NP_525008.2 | UDPGT | 12..523 | CDD:278624 | 56/243 (23%) |
egt | 13..483 | CDD:223071 | 56/243 (23%) | ||
AT4G14090 | NP_193146.1 | YjiC | 11..445 | CDD:224732 | 56/243 (23%) |
Glycosyltransferase_GTB_type | 12..454 | CDD:299143 | 56/243 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X13 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |