DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT3G55710

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_191130.1 Gene:AT3G55710 / 824737 AraportID:AT3G55710 Length:464 Species:Arabidopsis thaliana


Alignment Length:474 Identity:99/474 - (20%)
Similarity:173/474 - (36%) Gaps:149/474 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVVTI---LKPPSLH-----KDINHILVPMEEDILQAFNSVVGGMT 91
            |....:.:|.|...||.:||::..   ...||.|     :.|.|.....|:.:.|          
plant    19 HFNPMIELAGIFHNRGFSVTILHTSFNFPDPSRHPQFTFRTITHKNEGEEDPLSQ---------- 73

  Fly    92 KTDNSNAYVSMFRSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFDLVMVGYFMNCYQLAL---- 152
                              |||.|....|:...|:|..|..|....::...|........||    
plant    74 ------------------SETSSGKDLVVLISLLKQYYTEPSLAEEVGEGGTVCCLVSDALWGRN 120

  Fly   153 ----AHKLKV-PLVVALSNPPSFLGY-------------LLGNPWE--VSYVPGMSVS----IKG 193
                |.::.| .:|:..|...:|..|             :.|:..:  |:.:|.:.|.    ||.
plant   121 TEIVAKEIGVCTMVMRTSGAATFCAYTAFPLLIDKGYLPIQGSRLDELVTELPPLKVKDLPVIKT 185

  Fly   194 GKPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFASHGIS 258
            .:|.|. :|:||.:             :..|::...:..:     ::|||.:         |.:.
plant   186 KEPEGL-NRILNDM-------------VEGAKLSSGVVWN-----TFEDLER---------HSLM 222

  Fly   259 EGPIRPNVPAVIEIGGI-----QVKEQPERLPQNMEQFLS-----EAPNGAILLSLGS--NLKED 311
            :...:..|| :..||..     .:..:|:...::.::.|:     :||...:.:|.||  .::|:
plant   223 DCRSKLQVP-LFPIGPFHKHRTDLPPKPKNKDKDDDEILTDWLNKQAPQSVVYVSFGSLAAIEEN 286

  Fly   312 H-------LKSSTVQKMFNVLSKLQQKVIWKWDDLDNIP-GESENILYS----KWVPQVDVLAHP 364
            .       |::|.:..::.|...:.:...|    |:::| |..|||.:.    |||.|::.||||
plant   287 EFFEIAWGLRNSELPFLWVVRPGMVRGTEW----LESLPCGFLENIGHQGKIVKWVNQLETLAHP 347

  Fly   365 NITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNA---------------------------- 401
            .:..|.||.|.....|:...|.||:..|.|.||..||                            
plant   348 AVGAFWTHCGWNSTIESICEGVPMICTPCFSDQHVNARYIVDVWRVGMMLERCKMERTEIEKVVT 412

  Fly   402 DVMVMHGFGIKQSILTLEE 420
            .||:.:|.|:.:..|.|:|
plant   413 SVMMENGAGLTEMCLELKE 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 99/474 (21%)
egt 13..483 CDD:223071 99/474 (21%)
AT3G55710NP_191130.1 Glycosyltransferase_GTB_type 1..454 CDD:299143 99/474 (21%)
YjiC 7..421 CDD:224732 95/462 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.