DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT73C7

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_190884.1 Gene:UGT73C7 / 824482 AraportID:AT3G53160 Length:490 Species:Arabidopsis thaliana


Alignment Length:439 Identity:93/439 - (21%)
Similarity:163/439 - (37%) Gaps:116/439 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LSPSHLVIQMSMARILAER-GHNVTVVTI----------LKPPSLHKDINHILVPMEEDILQAFN 84
            ::..|::..:.::|:|::| |..|.::|.          |...||...||.:    |...|....
plant    15 MAQGHMIPLVDISRLLSQRQGVTVCIITTTQNVAKIKTSLSFSSLFATINIV----EVKFLSQQT 75

  Fly    85 SVVGGMTKTD---NSNAYVSMFRSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFDLVMVGYFMN 146
            .:..|....|   :....|..|.:...|.|...|..:.|.||       .|.     .::|....
plant    76 GLPEGCESLDMLASMGDMVKFFDAANSLEEQVEKAMEEMVQP-------RPS-----CIIGDMSL 128

  Fly   147 CYQLALAHKLKVPLVVALSNPPSFLGY------------------LLGNPWEVSYVPGMSVSIKG 193
            .:...||.|.|:|.::       |.|:                  ::.:..|...:||:...::.
plant   129 PFTSRLAKKFKIPKLI-------FHGFSCFSLMSIQVVRESGILKMIESNDEYFDLPGLPDKVEF 186

  Fly   194 GKPLGFGHRVLNLL----GSMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIF--- 251
            .||      .:::|    |:|.:.... |||..|     :.||  ..:.::|:|..:.:..:   
plant   187 TKP------QVSVLQPVEGNMKESTAK-IIEADN-----DSYG--VIVNTFEELEVDYAREYRKA 237

  Fly   252 FASHGISEGPIRPNVPAVIEIGGIQVKEQPERLPQNME---QFLSEAPNGAIL-LSLGS------ 306
            .|......||:     ::....|:...::.::.....:   |:|.....|::| :.|||      
plant   238 RAGKVWCVGPV-----SLCNRLGLDKAKRGDKASIGQDQCLQWLDSQETGSVLYVCLGSLCNLPL 297

  Fly   307 -NLKEDHLKSSTVQKMFNVLSKLQQKVIW------KWDDLDNIPGES--------ENILYSKWVP 356
             .|||..|......|.|          ||      |:.||.|...:|        ..::...|.|
plant   298 AQLKELGLGLEASNKPF----------IWVIREWGKYGDLANWMQQSGFEERIKDRGLVIKGWAP 352

  Fly   357 QVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMV 405
            ||.:|:|.:|..|:||.|.....|....|.|:|..|:|.:|..|..::|
plant   353 QVFILSHASIGGFLTHCGWNSTLEGITAGVPLLTWPLFAEQFLNEKLVV 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 93/439 (21%)
egt 13..483 CDD:223071 93/439 (21%)
UGT73C7NP_190884.1 Glycosyltransferase_GTB_type 7..489 CDD:299143 93/439 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2282
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.