DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT76E11

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_190251.1 Gene:UGT76E11 / 823820 AraportID:AT3G46670 Length:451 Species:Arabidopsis thaliana


Alignment Length:435 Identity:87/435 - (20%)
Similarity:160/435 - (36%) Gaps:109/435 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QIVVLIAGAHGANILGLFTSLSPSHLVIQMSMARILAERGHNVTVV----TILKPPSLHKDINHI 71
            ::|::...|.|             |:...|.:|:.|..:|.::|:.    ....|.....|...:
plant     9 RVVLVAVPAQG-------------HISPIMQLAKTLHLKGFSITIAQTKFNYFSPSDDFTDFQFV 60

  Fly    72 LVPMEEDILQAFNSVVGGMTKTDNSNAYVSMFRSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKF 136
            .:|  |.:.::....:|.:......|         ::...:|.   |.:.|.|::.     .|:.
plant    61 TIP--ESLPESDFEDLGPIEFLHKLN---------KECQVSFK---DCLGQLLLQQ-----GNEI 106

  Fly   137 DLVMVGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGFGH 201
            ..|:...|| .:..|.|.:.|:|.|:  .:..|...::..:.::..|...:...:|  :|.|..:
plant   107 ACVVYDEFM-YFAEAAAKEFKLPNVI--FSTTSATAFVCRSAFDKLYANSILTPLK--EPKGQQN 166

  Fly   202 RVLNLLGSMAQRLFMFIIELRNARIYREIYGDDP-----TLPSYEDLHKNI-------SLIF--- 251
            .:              :.|....|.     .|.|     :|.|..:|::|.       |:|.   
plant   167 EL--------------VPEFHPLRC-----KDFPVSHWASLESMMELYRNTVDKRTASSVIINTA 212

  Fly   252 --FASHGISEGPIRPNVPAVIEIGGIQV--KEQPERLPQN---MEQFLSEAPNGAILLSLGSNLK 309
              ..|..:|....:..:| |..||.:.:  ......|.:|   :|....:..|..|.:||||   
plant   213 SCLESSSLSRLQQQLQIP-VYPIGPLHLVASASTSLLEENKSCIEWLNKQKKNSVIFVSLGS--- 273

  Fly   310 EDHLKSSTVQKMFNV---LSKLQQKVIW----------KWDDLDNIPGESENILYS-----KWVP 356
               |....:.::...   |...:|:.:|          :|  ::|:|.|...|:..     ||.|
plant   274 ---LALMEINEVIETALGLDSSKQQFLWVIRPGSVRGSEW--IENLPKEFSKIISGRGYIVKWAP 333

  Fly   357 QVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNA 401
            |.:||:||.:..|.:|.|.....|:...|.||:..|...||..||
plant   334 QKEVLSHPAVGGFWSHCGWNSTLESIGEGVPMICKPFSSDQMVNA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 87/434 (20%)
egt 13..483 CDD:223071 87/433 (20%)
UGT76E11NP_190251.1 PLN02410 1..451 CDD:178032 87/435 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.