DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT76E12

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_566885.1 Gene:UGT76E12 / 823819 AraportID:AT3G46660 Length:458 Species:Arabidopsis thaliana


Alignment Length:419 Identity:85/419 - (20%)
Similarity:151/419 - (36%) Gaps:110/419 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVV-TILKPPSLHKDINHILVPMEEDILQAFNSVVGGMTKTD--NS 96
            |:...|.:|:.|..:|.::||| |.....|...|..|..         .|.::...:.::|  |.
plant    25 HISPMMQLAKTLHLKGFSITVVQTKFNYFSPSDDFTHDF---------QFVTIPESLPESDFKNL 80

  Fly    97 NAYVSMFRSVRQLSETFSK-MGDVMKQPLVKDLYEHPDNKFDLVMVGYFMNCYQLALAHKLKVPL 160
            .....:|:..::...:|.. :|.::.|         ..|:...|:...|| .:..|.|.:.|:|.
plant    81 GPIQFLFKLNKECKVSFKDCLGQLVLQ---------QSNEISCVIYDEFM-YFAEAAAKECKLPN 135

  Fly   161 VVALSNPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGFGHRVLNLLGSMAQRLFMFIIELRNAR 225
            ::  .:..|...:...:.::..|...:...:|..|             ...:.|......||   
plant   136 II--FSTTSATAFACRSVFDKLYANNVQAPLKETK-------------GQQEELVPEFYPLR--- 182

  Fly   226 IYREIYGDDP-----TLPSYEDLHKNI--------------------SLIFFASHGISEGPIRPN 265
                 |.|.|     :|.|..::::|.                    ||.|.....: :.|:.| 
plant   183 -----YKDFPVSRFASLESIMEVYRNTVDKRTASSVIINTASCLESSSLSFLQQQQL-QIPVYP- 240

  Fly   266 VPAVIEIGGI-QVKEQPERLPQN----MEQFLSEAPNGAILLSLGSNLKEDHLKSSTVQKMFNVL 325
                  ||.: .|...|..|.:.    :|....:..|..|.:|:||      :....:.::..|.
plant   241 ------IGPLHMVASAPTSLLEENKSCIEWLNKQKVNSVIYISMGS------IALMEINEIMEVA 293

  Fly   326 SKL---QQKVIW----------KWDDLDNIPGESENILYS-----KWVPQVDVLAHPNITLFITH 372
            |.|   .|..:|          :|  ::::|.|...::..     ||.||.:||:||.:..|.:|
plant   294 SGLAASNQHFLWVIRPGSIPGSEW--IESMPEEFSKMVLDRGYIVKWAPQKEVLSHPAVGGFWSH 356

  Fly   373 AGKGGLTEAQYHGKPMLALPVFGDQPSNA 401
            .|.....|:...|.||:..|..|||..||
plant   357 CGWNSTLESIGQGVPMICRPFSGDQKVNA 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 85/419 (20%)
egt 13..483 CDD:223071 85/419 (20%)
UGT76E12NP_566885.1 PLN02410 6..458 CDD:178032 85/419 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.