DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT3G46650

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_190249.4 Gene:AT3G46650 / 823818 AraportID:AT3G46650 Length:435 Species:Arabidopsis thaliana


Alignment Length:401 Identity:77/401 - (19%)
Similarity:146/401 - (36%) Gaps:93/401 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVVTILKPPSLHKDINHI-----------LVPMEEDILQAFNSVVG 88
            |:...|.:.::|..:|.::|||        ....|.:           .|.::|.:.::....:|
plant    21 HVTPLMQLGKVLNSKGFSITVV--------EGHFNQVSSSSQHFPGFQFVTIKESLPESEFEKLG 77

  Fly    89 GMTKTDNSNAYVSMFRSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFDLVMVGYFMNCYQLALA 153
            |:.         ||.        |.:|..:...:..:..|.....|....::...:| .:..|.|
plant    78 GIE---------SMI--------TLNKTSEASFKDCISQLLLQQGNDIACIIYDEYM-YFCGAAA 124

  Fly   154 HKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGFGHRVLNLLGSMAQRLFMFI 218
            .:..:|.|:  .:..|...|       ||:.......::...||.:.....:.:|.: .|.|...
plant   125 KEFSIPSVI--FSTQSAANY-------VSHPDMQDKVVENLYPLRYKDLPTSGMGPL-DRFFELC 179

  Fly   219 IELRNARIYREIYGDDPTLPSYED-----LHKNISLIFFASHGISEGPIRPNVPAVIEIGGIQVK 278
            .|:.|.|....:..:  |:...|.     |.:.:        |||..|:.|          :.:.
plant   180 REVANKRTASAVIIN--TVSCLESSSLSWLEQKV--------GISVYPLGP----------LHMT 224

  Fly   279 E-QPERLPQN----MEQFLSEAPNGAILLSLGSNLKEDHLKSSTVQKMFNVLSKLQQKVIW---- 334
            : .|..|.:.    :|....:.|...|.:|:|:   ...:::..|.:|...|....|..:|    
plant   225 DSSPSSLLEEDRSCIEWLNKQKPKSVIYISIGT---LGQMETKEVLEMSWGLCNSNQPFLWVIRA 286

  Fly   335 ----KWDDLDNIPGE-----SENILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLA 390
                ..:.::::|.:     ||.....|..||::||.||.:..|.:|.|...:.|:...|.||:.
plant   287 GSILGTNGIESLPEDVNKMVSERGYIVKRAPQIEVLGHPAVGGFWSHCGWNSILESIGEGVPMIC 351

  Fly   391 LPVFGDQPSNA 401
            .|..|:|..||
plant   352 KPFHGEQKLNA 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 77/401 (19%)
egt 13..483 CDD:223071 77/401 (19%)
AT3G46650NP_190249.4 Glycosyltransferase_GTB-type 1..435 CDD:385653 77/401 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.