DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT3G21790

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_188816.1 Gene:AT3G21790 / 821733 AraportID:AT3G21790 Length:495 Species:Arabidopsis thaliana


Alignment Length:459 Identity:88/459 - (19%)
Similarity:175/459 - (38%) Gaps:115/459 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVVTILKP-------------PSLHKDINHILVPMEEDILQAFNSV 86
            ||...:.||::|.:|...:::..|:.|             .:|....|:.|   ..:::.|.:..
plant    15 HLRSTVEMAKLLVDRETRLSISVIILPFISEGEVGASDYIAALSASSNNRL---RYEVISAVDQP 76

  Fly    87 VGGMTKTDNSNAYVSMFRSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFDLVMVGYFMNCYQLA 151
            ...||..:     :.|.....::..|.:|        |::|....||:.   .:.|:.::.:..:
plant    77 TIEMTTIE-----IHMKNQEPKVRSTVAK--------LLEDYSSKPDSP---KIAGFVLDMFCTS 125

  Fly   152 LAHKLKVPLVVALSNP---PSFLGYLLG----------------NPWEVS---YVPGMSVSIKGG 194
            :         |.::|.   ||::.|...                |.::||   |..  |.::...
plant   126 M---------VDVANEFGFPSYMFYTSSAGILSVTYHVQMLCDENKYDVSENDYAD--SEAVLNF 179

  Fly   195 KPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFASHGISE 259
            ..|...:.|..|..::|..:::.:. :..||.:||:.|  ..:.:..:|...: |.|.:|.  ..
plant   180 PSLSRPYPVKCLPHALAANMWLPVF-VNQARKFREMKG--ILVNTVAELEPYV-LKFLSSS--DT 238

  Fly   260 GPIRPNVPAVIEIGGIQVKEQPERLPQNMEQFLSEAPNGAILLSLGS--NLKEDHLKSSTVQKMF 322
            .|:.| |..::.:...:...:.|:..:.:.....:.|:..:.|..||  ...|:.::...:    
plant   239 PPVYP-VGPLLHLENQRDDSKDEKRLEIIRWLDQQPPSSVVFLCFGSMGGFGEEQVREIAI---- 298

  Fly   323 NVLSKLQQKVIWKW-----DDLDNIPGESENI-------LYSK---------WVPQVDVLAHPNI 366
             .|.:...:.:|..     :....:|||..|:       .:.:         |.|||.|||:|.|
plant   299 -ALERSGHRFLWSLRRASPNIFKELPGEFTNLEEVLPEGFFDRTKDIGKVIGWAPQVAVLANPAI 362

  Fly   367 TLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMV---------------MHGFGIKQSIL 416
            ..|:||.|.....|:.:.|.|..|.|::.:|..||.:||               .|..|:..:.:
plant   363 GGFVTHCGWNSTLESLWFGVPTAAWPLYAEQKFNAFLMVEELGLAVEIRKYWRGEHLAGLPTATV 427

  Fly   417 TLEE 420
            |.||
plant   428 TAEE 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 88/459 (19%)
egt 13..483 CDD:223071 88/459 (19%)
AT3G21790NP_188816.1 PLN02554 1..483 CDD:215304 88/459 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.