DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and HYR1

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_188813.1 Gene:HYR1 / 821730 AraportID:AT3G21760 Length:485 Species:Arabidopsis thaliana


Alignment Length:491 Identity:97/491 - (19%)
Similarity:185/491 - (37%) Gaps:147/491 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SP--SHLVIQMSMARILAERGHNVTVVTILKPPSLH----KDINHILVPMEEDILQAFN-SVVGG 89
            ||  .||...:.:|::..:|..::: :||:..|.:|    .:.:..:..:..|..:..: :|:..
plant    10 SPGDGHLRPLVEVAKLHVDRDDHLS-ITIIIIPQMHGFSSSNSSSYIASLSSDSEERLSYNVLSV 73

  Fly    90 MTKTDNSNA------YVSMFRSVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFDLVMVGYFMNCY 148
            ..|.|:.:.      |:..|:.  |:..|..|:.|  ..|        ||:...|  .|:.::.:
plant    74 PDKPDSDDTKPHFFDYIDNFKP--QVKATVEKLTD--PGP--------PDSPSRL--AGFVVDMF 124

  Fly   149 ---QLALAHKLKVPLVVALSNPPSFLG------YL-----------------------LGNPWEV 181
               .:.:|::..||..:..::..:|||      ||                       |..|..|
plant   125 CMMMIDVANEFGVPSYMFYTSNATFLGLQVHVEYLYDVKNYDVSDLKDSDTTELEVPCLTRPLPV 189

  Fly   182 SYVPGMSVSIKGGKPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKN 246
            ...|.:.:: |...|:.|                      |..|.:||..|  ..:.::.:|...
plant   190 KCFPSVLLT-KEWLPVMF----------------------RQTRRFRETKG--ILVNTFAELEPQ 229

  Fly   247 ISLIFFASHGISEGPIRPNVPAVIEIGGIQVK-------EQPERLPQNMEQFLSEAP-NGAILLS 303
             ::.||:  |: :.|: |.|..|..:..:::.       :|.|.|     ::|.|.| ...:.|.
plant   230 -AMKFFS--GV-DSPL-PTVYTVGPVMNLKINGPNSSDDKQSEIL-----RWLDEQPRKSVVFLC 284

  Fly   304 LGS--NLKEDHLKSSTVQKMFNVLSKLQQKVIW---------------KWDDLDNIPGE------ 345
            .||  ..:|...|...:     .|.:...:.:|               ::.:|:.|..|      
plant   285 FGSMGGFREGQAKEIAI-----ALERSGHRFVWSLRRAQPKGSIGPPEEFTNLEEILPEGFLERT 344

  Fly   346 SENILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMH-GF 409
            :|......|.||..:||:|.|..|::|.|.....|:.:.|.||...|::.:|..||..||.. |.
plant   345 AEIGKIVGWAPQSAILANPAIGGFVSHCGWNSTLESLWFGVPMATWPLYAEQQVNAFEMVEELGL 409

  Fly   410 GIK-------------QSILTLEEDSFLQGIREVLD 432
            .::             ..::|.||  ..:|||.:::
plant   410 AVEVRNSFRGDFMAADDELMTAEE--IERGIRCLME 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 97/491 (20%)
egt 13..483 CDD:223071 97/491 (20%)
HYR1NP_188813.1 PLN02554 1..485 CDD:215304 97/491 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.