DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT84A2

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_188793.1 Gene:UGT84A2 / 821710 AraportID:AT3G21560 Length:496 Species:Arabidopsis thaliana


Alignment Length:466 Identity:93/466 - (19%)
Similarity:177/466 - (37%) Gaps:117/466 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVVTI----LKPPSLHKDINHILVPMEEDILQAFNSVVGGMTKTDN 95
            |:...:.:.::||.:|..:|.||.    .|....:|..:.:|.|:.:..|: ::....|:.:.|.
plant    23 HVNPLLRLGKLLASKGLLITFVTTESWGKKMRISNKIQDRVLKPVGKGYLR-YDFFDDGLPEDDE 86

  Fly    96 -SNAYVSMFR------SVRQLSETFSKMGDVMKQPLVKDLYEHPDNKFDLVMVGYFMNCYQLALA 153
             |...:::.|      ..|::.....:..:|.||| |..|..:|           |:: :...:|
plant    87 ASRTNLTILRPHLELVGKREIKNLVKRYKEVTKQP-VTCLINNP-----------FVS-WVCDVA 138

  Fly   154 HKLKVPLVVA-LSNPPSFLGY------LLGNPWEVSYVPGMSVSIKGGKPLGFGHRVLNLLGSMA 211
            ..|::|..|. :.:......|      |:..|.:..  |.:.|.| .|.||              
plant   139 EDLQIPCAVLWVQSCACLAAYYYYHHNLVDFPTKTE--PEIDVQI-SGMPL-------------- 186

  Fly   212 QRLFMFIIELRNARIYREIYGDDP-------TLPSYEDLHKNISLIFFASHGISE---------- 259
                     |::..|...|:...|       .:...:.|||..|:.....:.:.:          
plant   187 ---------LKHDEIPSFIHPSSPHSALREVIIDQIKRLHKTFSIFIDTFNSLEKDIIDHMSTLS 242

  Fly   260 --GPIRPNVP-------AVIEIGGIQVKEQPERLPQNMEQFLSEAPNGAILLSLGSNLKEDHLKS 315
              |.|||..|       ...::..:.:.|..:..   ||...|:..:..:.:|.|:   ..:||.
plant   243 LPGVIRPLGPLYKMAKTVAYDVVKVNISEPTDPC---MEWLDSQPVSSVVYISFGT---VAYLKQ 301

  Fly   316 STVQKM-FNVLSKLQQKVIWKW----DDL----------DNIPGESENILYSKWVPQVDVLAHPN 365
            ..:.:: :.||:   ..|.:.|    .:|          :.:.|:.:.:   :|..|..||:||:
plant   302 EQIDEIAYGVLN---ADVTFLWVIRQQELGFNKEKHVLPEEVKGKGKIV---EWCSQEKVLSHPS 360

  Fly   366 ITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMV-MHGFGIKQSILTLEE-----DSFL 424
            :..|:||.|.....||...|.|.:..|.:|||.::|..|: :...|::.|....||     :...
plant   361 VACFVTHCGWNSTMEAVSSGVPTVCFPQWGDQVTDAVYMIDVWKTGVRLSRGEAEERLVPREEVA 425

  Fly   425 QGIREVLDNPK 435
            :.:|||....|
plant   426 ERLREVTKGEK 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 93/466 (20%)
egt 13..483 CDD:223071 93/466 (20%)
UGT84A2NP_188793.1 Glycosyltransferase_GTB-type 1..485 CDD:415824 93/466 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.