DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT76B1

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_187742.1 Gene:UGT76B1 / 820307 AraportID:AT3G11340 Length:447 Species:Arabidopsis thaliana


Alignment Length:526 Identity:113/526 - (21%)
Similarity:180/526 - (34%) Gaps:148/526 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ILGLFTSLSPSHLVIQMSMARILAERGHNVTVVTILKPPSLHKDINHILVPMEEDILQ-AFNSVV 87
            ::.||......||.....:|.|...||.::||:        |.:.|.   |...:... .|.|:.
plant     9 VIFLFPFPLQGHLNPMFQLANIFFNRGFSITVI--------HTEFNS---PNSSNFPHFTFVSIP 62

  Fly    88 GGMTKTDNSNAYVSMFRSVRQL-SETFSKMGDVMKQPLVKDLYEHPDNKFDLV-MVGYFMNCYQL 150
            ..:::.:   :|..:...:..| |:..:..||.:|    |.:.|.|.....:| .:.||.:    
plant    63 DSLSEPE---SYPDVIEILHDLNSKCVAPFGDCLK----KLISEEPTAACVIVDALWYFTH---- 116

  Fly   151 ALAHKLKVP-LVVALSNPPSFL-----------GYL-------------------LGNPWEVSYV 184
            .|..|...| :|:...|..:|:           |||                   ...||..:..
plant   117 DLTEKFNFPRIVLRTVNLSAFVAFSKFHVLREKGYLSLQETKADSPVPELPYLRMKDLPWFQTED 181

  Fly   185 PGMSVSIKGGKPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISL 249
            |      :.|..|..|  |:..|.|.:..:|..|.:|...::      |:             :.
plant   182 P------RSGDKLQIG--VMKSLKSSSGIIFNAIEDLETDQL------DE-------------AR 219

  Fly   250 IFFASHGISEGPIRPNVPAVIEIGGIQVKEQPERLPQNME--QFL-SEAPNGAILLSLGSNLKED 311
            |.|.......||....|.|          .....|..:|.  .:| .:|.|..|..||||....|
plant   220 IEFPVPLFCIGPFHRYVSA----------SSSSLLAHDMTCLSWLDKQATNSVIYASLGSIASID 274

  Fly   312 HLKSSTVQKMFNVLSKLQQKVIW----------KWDD------LDNIPGESENILYSKWVPQVDV 360
              :|..::..:. |....|..:|          :|.:      ::|:.|..:.:   ||.||.:|
plant   275 --ESEFLEIAWG-LRNSNQPFLWVVRPGLIHGKEWIEILPKGFIENLEGRGKIV---KWAPQPEV 333

  Fly   361 LAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNA----DVMVMHGFGIKQSILTLEED 421
            |||.....|:||.|.....|......||:..|.||||..||    ||..: |..::..:..|   
plant   334 LAHRATGGFLTHCGWNSTLEGICEAIPMICRPSFGDQRVNARYINDVWKI-GLHLENKVERL--- 394

  Fly   422 SFLQGIREVLDNPKYATAVKSFSTLYRDRPLSPRETLIYWVEYVIRYHGAPHIQSPVVHMSYIAA 486
                    |::|........|.....|.|.:..:||    ||..::..|:          |:...
plant   395 --------VIENAVRTLMTSSEGEEIRKRIMPMKET----VEQCLKLGGS----------SFRNL 437

  Fly   487 NNLDVY 492
            .||..|
plant   438 ENLIAY 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 113/526 (21%)
egt 13..483 CDD:223071 109/515 (21%)
UGT76B1NP_187742.1 Glycosyltransferase_GTB-type 1..444 CDD:415824 113/526 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.