DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT74F2

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_181910.1 Gene:UGT74F2 / 818986 AraportID:AT2G43820 Length:449 Species:Arabidopsis thaliana


Alignment Length:415 Identity:88/415 - (21%)
Similarity:154/415 - (37%) Gaps:139/415 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GGMTKTDNSNAYVSMFRSVRQLSETFSK-MGDVMKQ------PLVKDLYE-------HPDNKFDL 138
            ||....|:.:.|:..|::      :.|| :.|::::      |:...:|:       ....:|.|
plant    68 GGFETADSIDDYLKDFKT------SGSKTIADIIQKHQTSDNPITCIVYDAFLPWALDVAREFGL 126

  Fly   139 VMVGYFMN-C-----YQLALAH--KLKVPL----VVALSNPPSFLGYLLGNPWEVSYVPGMSVSI 191
            |...:|.. |     |.|:..:  .|::|:    .:.|.:.|||.                  |:
plant   127 VATPFFTQPCAVNYVYYLSYINNGSLQLPIEELPFLELQDLPSFF------------------SV 173

  Fly   192 KGGKPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFASHG 256
            .|..|..| ..||....:..:..|:.:      ..::|:           :||:| .|...|...
plant   174 SGSYPAYF-EMVLQQFINFEKADFVLV------NSFQEL-----------ELHEN-ELWSKACPV 219

  Fly   257 ISEGPIRPNVPAVIEIGGIQVKEQPERLPQNME-------------------QFLSEAPNGAIL- 301
            ::.||..|::                .|.|.::                   .:|...|.|::: 
plant   220 LTIGPTIPSI----------------YLDQRIKSDTGYDLNLFESKDDSFCINWLDTRPQGSVVY 268

  Fly   302 LSLGS-----NLKEDHLKSSTVQKMFNVLSKLQQKVIW--KWDDLDNIPG------ESENILYSK 353
            ::.||     |::.:.|.|:.....|          :|  :..:.:.:|.      ..|..|..|
plant   269 VAFGSMAQLTNVQMEELASAVSNFSF----------LWVVRSSEEEKLPSGFLETVNKEKSLVLK 323

  Fly   354 WVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNA----DVMVMHGFGIK-- 412
            |.||:.||::..|..|:||.|.....||...|.||:|:|.:.|||.||    ||. ..|..:|  
plant   324 WSPQLQVLSNKAIGCFLTHCGWNSTMEALTFGVPMVAMPQWTDQPMNAKYIQDVW-KAGVRVKTE 387

  Fly   413 --QSILTLEEDSFLQGIREVLDNPK 435
              ..|...||..|  .|:||::..:
plant   388 KESGIAKREEIEF--SIKEVMEGER 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 88/415 (21%)
egt 13..483 CDD:223071 88/415 (21%)
UGT74F2NP_181910.1 PLN02173 1..449 CDD:177830 88/415 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.