DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT2G36970

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_181234.1 Gene:AT2G36970 / 818271 AraportID:AT2G36970 Length:490 Species:Arabidopsis thaliana


Alignment Length:435 Identity:86/435 - (19%)
Similarity:161/435 - (37%) Gaps:117/435 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVVTILKPPSLHKDINHILVPMEEDILQAFNSV------------- 86
            |::..:.:|..||..|..:|.|   ...|:|   :||....::|....|::.             
plant    21 HVIPFVHLAIKLASHGFTITFV---NTDSIH---HHISTAHQDDAGDIFSAARSSGQHDIRYTTV 79

  Fly    87 -VGGMTKTDNSNAYVSMFRS--------VRQLSETFSKMGDVMKQPLVKDLY----EHPDNKFDL 138
             .|.....|.|..:...|..        |..|....|:..|.....|:.|.:    ....:|.:|
plant    80 SDGFPLDFDRSLNHDQFFEGILHVFSAHVDDLIAKLSRRDDPPVTCLIADTFYVWSSMICDKHNL 144

  Fly   139 VMVGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYL--LGNPWEV-SYVPGMSVSIKGGKPLGFG 200
            |.|.::.   :.||...|...:.:.:||     |:.  |.|..:| .||||    :|..:|    
plant   145 VNVSFWT---EPALVLNLYYHMDLLISN-----GHFKSLDNRKDVIDYVPG----VKAIEP---- 193

  Fly   201 HRVLNLLGSMAQRLFMFIIEL------RNARIYREIYGDDPTLPSYEDLHKNISLIFFASHGISE 259
                        :..|..:::      .|..:||.::      .:::|:.:   ..|...:.:.|
plant   194 ------------KDLMSYLQVSDKDVDTNTVVYRILF------KAFKDVKR---ADFVVCNTVQE 237

  Fly   260 GPIRPNVPAVIEIGGIQVKEQ--------------PERL--PQNMEQFLSEAPNGAIL-LSLGSN 307
              :.|:     .:..:|.|:.              |..|  ..:..::|...|.|::| :|.||.
plant   238 --LEPD-----SLSALQAKQPVYAIGPVFSTDSVVPTSLWAESDCTEWLKGRPTGSVLYVSFGSY 295

  Fly   308 LKEDHLKSSTVQKMFNVLSKLQQKVIWKW-DDL--DNIPG---------ESENILYSKWVPQVDV 360
            .   |:....:.::.:.|.......||.. .|:  .|:|.         ..:..|..:|..|::|
plant   296 A---HVGKKEIVEIAHGLLLSGISFIWVLRPDIVGSNVPDFLPAGFVDQAQDRGLVVQWCCQMEV 357

  Fly   361 LAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMV 405
            :::|.:..|.||.|...:.|:.:.|.|:|..|:..||.:|..::|
plant   358 ISNPAVGGFFTHCGWNSILESVWCGLPLLCYPLLTDQFTNRKLVV 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 86/435 (20%)
egt 13..483 CDD:223071 86/435 (20%)
AT2G36970NP_181234.1 Glycosyltransferase_GTB_type 1..470 CDD:299143 86/435 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.