DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT73C6

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_181217.1 Gene:UGT73C6 / 818251 AraportID:AT2G36790 Length:495 Species:Arabidopsis thaliana


Alignment Length:450 Identity:94/450 - (20%)
Similarity:169/450 - (37%) Gaps:130/450 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LFTSLSPSHLVIQMSMARILAERGHNVTVVTILKPPSLHKD-----------INHILV--PMEED 78
            ||..::..|::..:.:||:||:||..:|:||.....:..|:           ||.:.|  |.:|.
plant    16 LFPFMAQGHMIPMVDIARLLAQRGVLITIVTTPHNAARFKNVLNRAIESGLPINLVQVKFPYQEA 80

  Fly    79 ILQAFNSVVGGMTKTDNSNAYVSMFRSVRQLSETFSKMGDVMKQP---LVKDLYEHPDNKFDLVM 140
            .||.      |....|       :..::.|:: :|.|..:::|:|   |::::...|.     .:
plant    81 GLQE------GQENMD-------LLTTMEQIT-SFFKAVNLLKEPVQNLIEEMSPRPS-----CL 126

  Fly   141 VGYFMNCYQLALAHKLKVPLVV--------------------ALSNPPSFLGYLLGNPWEVSYVP 185
            :......|...:|.|.|:|.::                    .|.|..|...|.:     |.|.|
plant   127 ISDMCLSYTSEIAKKFKIPKILFHGMGCFCLLCVNVLRKNREILDNLKSDKEYFI-----VPYFP 186

  Fly   186 GM------SVSIKGGKPLGFGHRVLNLLGSMAQRLFMFIIELRNARIYREIYGD----DPT---- 236
            ..      .|.::...|.|                            ::||..|    |.|    
plant   187 DRVEFTRPQVPVETYVPAG----------------------------WKEILEDMVEADKTSYGV 223

  Fly   237 -LPSYEDLHKNISLIFFASHGISEGPIRPNVPAVIEIGGIQVKEQPERLPQNMEQFL----SEAP 296
             :.|:::|....:..|..:.......|.|  .::....|:...|:..:...:.::.|    |:.|
plant   224 IVNSFQELEPAYAKDFKEARSGKAWTIGP--VSLCNKVGVDKAERGNKSDIDQDECLEWLDSKEP 286

  Fly   297 NGAILLSLGSNLKEDHLKSSTVQKMFNVLSKLQQKVIW------KWDDL----------DNIPGE 345
            ...:.:.|||..   :|..|.:.::...|.:.|:..||      |:.:|          |.|  :
plant   287 GSVLYVCLGSIC---NLPLSQLLELGLGLEESQRPFIWVIRGWEKYKELVEWFSESGFEDRI--Q 346

  Fly   346 SENILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMV 405
            ...:|...|.||:.:|:||::..|:||.|.....|....|.|||..|:|.||..|..::|
plant   347 DRGLLIKGWSPQMLILSHPSVGGFLTHCGWNSTLEGITAGLPMLTWPLFADQFCNEKLVV 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 93/449 (21%)
egt 13..483 CDD:223071 93/449 (21%)
UGT73C6NP_181217.1 Glycosyltransferase_GTB-type 12..494 CDD:385653 93/449 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2282
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.