DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT2G36770

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_181215.1 Gene:AT2G36770 / 818249 AraportID:AT2G36770 Length:496 Species:Arabidopsis thaliana


Alignment Length:471 Identity:114/471 - (24%)
Similarity:193/471 - (40%) Gaps:108/471 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LFTSLSPSHLVIQMSMARILAERGHNVTVVT----------ILK---PPSLHKDINHILVPMEED 78
            ||..::..|::..:.:||:||:||..||:||          :|.   ...|..:|.|:..|.:| 
plant    17 LFPFMAQGHMIPMIDIARLLAQRGATVTIVTTRYNAGRFENVLSRAMESGLPINIVHVNFPYQE- 80

  Fly    79 ILQAFNSVVGGMTKTDNSNAYVSM------FRSVRQLSETFSKMGDVMK-QP--LVKDLY----E 130
                |....|    .:|.::|.||      |::|..|.:...|:.:.|| :|  ::.||.    .
plant    81 ----FGLPEG----KENIDSYDSMELMVPFFQAVNMLEDPVMKLMEEMKPRPSCIISDLLLPYTS 137

  Fly   131 HPDNKFDL-VMVGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMSVSIKGG 194
            ....||.: .:|.:...|:.|...|.|:..|.: |.|..|...|.|        ||.....::..
plant   138 KIARKFSIPKIVFHGTGCFNLLCMHVLRRNLEI-LKNLKSDKDYFL--------VPSFPDRVEFT 193

  Fly   195 KPLGFGHRVLNLLGSMAQRLFMFIIELRNARI--YREIYGDDPTL-PSY-EDLHK-------NIS 248
            ||      .:.:..:.:.....|:.|:..|..  |..|......| |:| :|..|       :|.
plant   194 KP------QVPVETTASGDWKAFLDEMVEAEYTSYGVIVNTFQELEPAYVKDYTKARAGKVWSIG 252

  Fly   249 LIFFASHGISEGPIRPNVPAVIEIGGIQVKEQPERLPQNMEQFLSEAPNGAIL-LSLGS--NLKE 310
            .:...:...::...|.|..|:         :|.|.|     |:|....:|::| :.|||  ||..
plant   253 PVSLCNKAGADKAERGNQAAI---------DQDECL-----QWLDSKEDGSVLYVCLGSICNLPL 303

  Fly   311 DHLKSSTVQKMFNVLSKLQQKVIW------KWDDLDNIPGES--------ENILYSKWVPQVDVL 361
            ..||...:.     |.|.|:..||      |:::|.....||        ..:|...|.|||.:|
plant   304 SQLKELGLG-----LEKSQRSFIWVIRGWEKYNELYEWMMESGFEERIKERGLLIKGWSPQVLIL 363

  Fly   362 AHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVM-----HGFGIKQSILTLEED 421
            :||::..|:||.|.....|....|.|::..|:||||..|..::|.     ...|:::.:...||:
plant   364 SHPSVGGFLTHCGWNSTLEGITSGIPLITWPLFGDQFCNQKLVVQVLKAGVSAGVEEVMKWGEEE 428

  Fly   422 SF-----LQGIREVLD 432
            ..     .:|:::.::
plant   429 KIGVLVDKEGVKKAVE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 114/471 (24%)
egt 13..483 CDD:223071 114/471 (24%)
AT2G36770NP_181215.1 Glycosyltransferase_GTB-type 13..495 CDD:415824 114/471 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2282
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.