DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT73C2

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_181214.1 Gene:UGT73C2 / 818248 AraportID:AT2G36760 Length:496 Species:Arabidopsis thaliana


Alignment Length:488 Identity:107/488 - (21%)
Similarity:189/488 - (38%) Gaps:142/488 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LFTSLSPSHLVIQMSMARILAERGHNVTVVT----------ILK---PPSLHKDINHILVPMEED 78
            ||..::..|::..:.:|||||:||..:|:||          :|.   ...||..:.|:..|.:|.
plant    17 LFPFMAQGHMIPMVDIARILAQRGVTITIVTTPHNAARFKDVLNRAIQSGLHIRVEHVKFPFQEA 81

  Fly    79 ILQAFNSVVGGMTKTDNSNAYVSMFRSVRQLSETFSKMGDVMK-QP--LVKDLYEHPDNKFDLVM 140
            .||.....|..:   |:....|..|::|..|.....|:.:.|| :|  |:.|             
plant    82 GLQEGQENVDFL---DSMELMVHFFKAVNMLENPVMKLMEEMKPKPSCLISD------------- 130

  Fly   141 VGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGFGHRVLN 205
               |...|...:|.:..:|.:|       |.|        ||....:|:.|.        ||..|
plant   131 ---FCLPYTSKIAKRFNIPKIV-------FHG--------VSCFCLLSMHIL--------HRNHN 169

  Fly   206 LLGSMAQRLFMFIIELRNARI----------------YREIY-----GDDPT----LPSYEDLH- 244
            :|.::......|::.....|:                ::||.     .||.:    :.:::||. 
plant   170 ILHALKSDKEYFLVPSFPDRVEFTKLQVTVKTNFSGDWKEIMDEQVDADDTSYGVIVNTFQDLES 234

  Fly   245 ---KNISLIFFASHGISEGPI------------RPNVPAVIEIGGIQVKEQPERLPQNMEQFL-S 293
               ||.:.. .|....|.||:            |.|..|:         :|.|.:     ::| |
plant   235 AYVKNYTEA-RAGKVWSIGPVSLCNKVGEDKAERGNKAAI---------DQDECI-----KWLDS 284

  Fly   294 EAPNGAILLSLGSNLKEDHLKSSTVQKMFNVLSKLQQKVIW------KWDDLDNIPGES------ 346
            :.....:.:.|||..   :|..:.::::...|...::..||      |:.:|.....||      
plant   285 KDVESVLYVCLGSIC---NLPLAQLRELGLGLEATKRPFIWVIRGGGKYHELAEWILESGFEERT 346

  Fly   347 --ENILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVM--- 406
              .::|...|.||:.:|:||.:..|:||.|.....|....|.|::..|:||||..|..::|.   
plant   347 KERSLLIKGWSPQMLILSHPAVGGFLTHCGWNSTLEGITSGVPLITWPLFGDQFCNQKLIVQVLK 411

  Fly   407 --HGFGIKQSILTLEEDSF-----LQGIREVLD 432
              ...|:::.:...||:|.     .:|:::.:|
plant   412 AGVSVGVEEVMKWGEEESIGVLVDKEGVKKAVD 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 107/488 (22%)
egt 13..483 CDD:223071 107/488 (22%)
UGT73C2NP_181214.1 Glycosyltransferase_GTB_type 13..495 CDD:299143 107/488 (22%)
YjiC 14..463 CDD:224732 107/488 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2282
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.