DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT73C1

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_181213.1 Gene:UGT73C1 / 818247 AraportID:AT2G36750 Length:491 Species:Arabidopsis thaliana


Alignment Length:498 Identity:102/498 - (20%)
Similarity:183/498 - (36%) Gaps:163/498 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LFTSLSPSHLVIQMSMARILAERGHNVTVVTILKPPSLHKD-----------INHILV--PMEED 78
            ||..::..|::..:.:||:||:||..:|:||..:.....|:           ||.:.|  |.:|.
plant    13 LFPFMAQGHMIPMVDIARLLAQRGVTITIVTTPQNAGRFKNVLSRAIQSGLPINLVQVKFPSQES 77

  Fly    79 ILQAFNSVVGGMTKTDNSNAYVSMFRSVRQLSETFSKMGDVMKQP---LVKDLYEHPDNKFDLVM 140
                     |.....:|.:...|:..|:     ||.|...::::|   |:|::...|        
plant    78 ---------GSPEGQENLDLLDSLGASL-----TFFKAFSLLEEPVEKLLKEIQPRP-------- 120

  Fly   141 VGYFMNC--------YQLALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPL 197
                 ||        |...:|..|.:|.::.                                  
plant   121 -----NCIIADMCLPYTNRIAKNLGIPKIIF---------------------------------- 146

  Fly   198 GFGHRVLNLLGS-MAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKN-ISLIFFA------- 253
             .|....|||.: :..:...|:..:.:.:.|..|    |..|...:..|: :.::..|       
plant   147 -HGMCCFNLLCTHIMHQNHEFLETIESDKEYFPI----PNFPDRVEFTKSQLPMVLVAGDWKDFL 206

  Fly   254 ---------SHGISEGPIRPNVPAVI------------EIGGIQV-----KEQPER-----LPQN 287
                     |:|:.........||.:            .||.:.:     ::|.||     :.|:
plant   207 DGMTEGDNTSYGVIVNTFEELEPAYVRDYKKVKAGKIWSIGPVSLCNKLGEDQAERGNKADIDQD 271

  Fly   288 -MEQFLSEAPNGAIL-LSLGS--NLKEDHLKSSTVQKMFNVLSKLQQKVIW------KWDDLDNI 342
             ..::|.....|::| :.|||  ||....||...:.     |.:.|:..||      |:::|...
plant   272 ECIKWLDSKEEGSVLYVCLGSICNLPLSQLKELGLG-----LEESQRPFIWVIRGWEKYNELLEW 331

  Fly   343 PGES--------ENILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPS 399
            ..||        ..:|.:.|.||:.:|.||.:..|:||.|.....|....|.|:|..|:||||..
plant   332 ISESGYKERIKERGLLITGWSPQMLILTHPAVGGFLTHCGWNSTLEGITSGVPLLTWPLFGDQFC 396

  Fly   400 NADVMVM---HGF--GIKQSILTLEEDSF-----LQGIREVLD 432
            |..:.|.   .|.  |:::|:...||:..     .:|:::.::
plant   397 NEKLAVQILKAGVRAGVEESMRWGEEEKIGVLVDKEGVKKAVE 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 102/498 (20%)
egt 13..483 CDD:223071 102/498 (20%)
UGT73C1NP_181213.1 Glycosyltransferase_GTB-type 1..487 CDD:385653 102/498 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2282
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.