DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT2G31790

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_180738.1 Gene:AT2G31790 / 817736 AraportID:AT2G31790 Length:457 Species:Arabidopsis thaliana


Alignment Length:458 Identity:100/458 - (21%)
Similarity:172/458 - (37%) Gaps:146/458 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVVTILKPPSLHKDINHILVPMEEDILQAFNSVVGGMTKTDNSNA- 98
            |:...:.:|:.|:::|...|::...|        :|......:|.....:::..|....::.:| 
plant    19 HINPMIQLAKRLSKKGITSTLIIASK--------DHREPYTSDDYSITVHTIHDGFFPHEHPHAK 75

  Fly    99 YVSMFR----SVRQLSETFS--KMGDVMKQPLVKDLYEHPDNKF--------DLVMVGYFMNCYQ 149
            :|.:.|    :.|.|::..|  |:.|...:.|:.|    |...|        ||.:|.||...:.
plant    76 FVDLDRFHNSTSRSLTDFISSAKLSDNPPKALIYD----PFMPFALDIAKDLDLYVVAYFTQPWL 136

  Fly   150 LALAH------KLKVPLVVALSNP--PSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGFGHRVLNL 206
            .:|.:      ...|| |....||  .||.|:.|.:..:   :|..:.. ||..||         
plant   137 ASLVYYHINEGTYDVP-VDRHENPTLASFPGFPLLSQDD---LPSFACE-KGSYPL--------- 187

  Fly   207 LGSMAQRLFMFIIELRNARIYREIYGDDPTL-PSYEDLH-------------KNISLIFFASHGI 257
                   |..|::     |.:..:...|..| .:::.|.             |||          
plant   188 -------LHEFVV-----RQFSNLLQADCILCNTFDQLEPKVVKWMNDQWPVKNI---------- 230

  Fly   258 SEGPIRPNVPAVIEIGGIQVKEQPERLPQNMEQFLSEA---PNGAILLSLGSNLKEDHLKSSTVQ 319
              ||:.|:            |....|||::.:..|..:   |:.::|..||:...:     |.|.
plant   231 --GPVVPS------------KFLDNRLPEDKDYELENSKTEPDESVLKWLGNRPAK-----SVVY 276

  Fly   320 KMFNVLSKLQQK---------------VIW--KWDDLDNIPG-------ESENILYSKWVPQVDV 360
            ..|..|..|.:|               .:|  :..:...:|.       |.::.|.:|||||::|
plant   277 VAFGTLVALSEKQMKEIAMAISQTGYHFLWSVRESERSKLPSGFIEEAEEKDSGLVAKWVPQLEV 341

  Fly   361 LAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMHGFGIKQSILTLEEDSFLQ 425
            |||.:|..|::|.|.....||...|.||:.:|.:.|||:||..:               ||.:..
plant   342 LAHESIGCFVSHCGWNSTLEALCLGVPMVGVPQWTDQPTNAKFI---------------EDVWKI 391

  Fly   426 GIR 428
            |:|
plant   392 GVR 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 100/458 (22%)
egt 13..483 CDD:223071 100/458 (22%)
AT2G31790NP_180738.1 Glycosyltransferase_GTB_type 3..454 CDD:299143 100/458 (22%)
YjiC 6..454 CDD:224732 100/458 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.