DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT87A2

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_180575.1 Gene:UGT87A2 / 817566 AraportID:AT2G30140 Length:455 Species:Arabidopsis thaliana


Alignment Length:456 Identity:102/456 - (22%)
Similarity:174/456 - (38%) Gaps:118/456 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMARILAERGHNVTVVTIL------------KPPSLHKDINHILVPME----EDILQAF 83
            |:...|::.:.|..|..|:.|..::            ||..:|......|:|.|    :|.:...
plant    24 HINPMMNLCKRLVRRYPNLHVTFVVTEEWLGFIGPDPKPDRIHFSTLPNLIPSELVRAKDFIGFI 88

  Fly    84 NSVVGGMTKTDNSNAYVSMFRSVRQLSETFSKMGDVMKQP----LVKDLYEHPDNKFDLVMVGYF 144
            ::|                   ..:|.|.|.|:.|.:..|    :..|.|.              
plant    89 DAV-------------------YTRLEEPFEKLLDSLNSPPPSVIFADTYV-------------- 120

  Fly   145 MNCYQLALAHKLKVPLVVALSNPPSFL------------GYLLGNPWE---VSYVPGMS-VSIKG 193
              .:.:.:..|..:|:|...:...:.|            |:.|..|.|   |.||||:| ..::.
plant   121 --IWAVRVGRKRNIPVVSLWTMSATILSFFLHSDLLISHGHALFEPSEEEVVDYVPGLSPTKLRD 183

  Fly   194 GKPL--GFGHRVLNLLGSMAQRLFMFIIELRNARI-YREIYGDDPTL--PSYEDLHKNISLIFFA 253
            ..|:  |:..||                 .:.|:: :.|:.|....|  .:||..||.|. .|.:
plant   184 LPPIFDGYSDRV-----------------FKTAKLCFDELPGARSLLFTTAYELEHKAID-AFTS 230

  Fly   254 SHGISEGPIRPNVPAVIEIGGIQVKEQPERLPQNMEQFLSEAPNGAIL-LSLGSNLKEDHLKSST 317
            ...|....|.|.:|..      ::..|.:....|..|:|.|.|.|::| :|.||.|.   :..:.
plant   231 KLDIPVYAIGPLIPFE------ELSVQNDNKEPNYIQWLEEQPEGSVLYISQGSFLS---VSEAQ 286

  Fly   318 VQKMFNVLSKLQQKVIW--KWDDL---DNIPGESENILYSKWVPQVDVLAHPNITLFITHAGKGG 377
            ::::...|.:...:.:|  :..:|   :.:.| |..::.| |..|:.||.|..:..|.||.|...
plant   287 MEEIVKGLRESGVRFLWVARGGELKLKEALEG-SLGVVVS-WCDQLRVLCHKAVGGFWTHCGFNS 349

  Fly   378 LTEAQYHGKPMLALPVFGDQPSNADVMVMHGFGIKQSILTLEEDSFLQGIREVLDNPKYATAVKS 442
            ..|..|.|.||||.|:|.||..||. |::..:.:...|...:::..|.|..|:.:      .||.
plant   350 TLEGIYSGVPMLAFPLFWDQILNAK-MIVEDWRVGMRIERTKKNELLIGREEIKE------VVKR 407

  Fly   443 F 443
            |
plant   408 F 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 102/456 (22%)
egt 13..483 CDD:223071 102/456 (22%)
UGT87A2NP_180575.1 PLN02448 2..455 CDD:215247 102/456 (22%)
YjiC 13..450 CDD:224732 102/456 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.