DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT71C1

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_180536.1 Gene:UGT71C1 / 817525 AraportID:AT2G29750 Length:481 Species:Arabidopsis thaliana


Alignment Length:507 Identity:99/507 - (19%)
Similarity:180/507 - (35%) Gaps:154/507 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HLVIQMSMA-RILAE---RGHNVTVV-----------TILKPPSLHKD---INHILVPMEED--I 79
            |::..:.:| |::::   |.|.:|::           ||....||.|:   |..:.:|..:|  .
plant    19 HILATIELAKRLISQDNPRIHTITILYWGLPFIPQADTIAFLRSLVKNEPRIRLVTLPEVQDPPP 83

  Fly    80 LQAFNSVVGGMTKTDNSNAYV-----SMFRSVRQLSETF----SKMGDVMKQPLVKDLYEHPDNK 135
            ::.|         .:.:.:|:     .|...:|:...|.    .:.|.|....||.|.:..|   
plant    84 MELF---------VEFAESYILEYVKKMVPIIREALSTLLSSRDESGSVRVAGLVLDFFCVP--- 136

  Fly   136 FDLVMVGYFMNCYQLALAHKLKVPLVVALSNPPSFLGYLLGNPWEVSYVPGMSVSIKGGKPLGFG 200
              ::.||           ::..:|..:.|:....|||.:       .|:|.....||......|.
plant   137 --MIDVG-----------NEFNLPSYIFLTCSAGFLGMM-------KYLPERHREIKSEFNRSFN 181

  Fly   201 HRVLNLLGS---------MAQRLFMFIIELRNARIYREIYGDDPTLPSYEDLHKNISLIFFASHG 256
            .. |||:..         :...|||           :|.|  :|.:...|.        |..:.|
plant   182 EE-LNLIPGYVNSVPTKVLPSGLFM-----------KETY--EPWVELAER--------FPEAKG 224

  Fly   257 I---SEGPIRP-----------NVPAVIEIGGIQVKEQPERLPQNMEQ----FLSEAPNGAILLS 303
            |   |...:.|           |.|.:..||.|........|..:...    :|.:.|..:::..
plant   225 ILVNSYTALEPNGFKYFDRCPDNYPTIYPIGPILCSNDRPNLDSSERDRIITWLDDQPESSVVFL 289

  Fly   304 LGSNLKEDHLKSSTVQKMFNVLSKLQQKVIWKW--------DDLDNIP-GESENI----LYSKWV 355
            ...:||  :|.::.:.::...|..:..|.||.:        ...:.:| |..:.:    :...|.
plant   290 CFGSLK--NLSATQINEIAQALEIVDCKFIWSFRTNPKEYASPYEALPHGFMDRVMDQGIVCGWA 352

  Fly   356 PQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMH-GFGIKQSILTLE 419
            |||::|||..:..|::|.|...:.|:...|.|:...|::.:|..||..||.. |..::..:..:.
plant   353 PQVEILAHKAVGGFVSHCGWNSILESLGFGVPIATWPMYAEQQLNAFTMVKELGLALEMRLDYVS 417

  Fly   420 ED--------------SFLQGI--------------REVLDNPKYATAVKSF 443
            ||              |.:.|:              :|.:|......|||.|
plant   418 EDGDIVKADEIAGTVRSLMDGVDVPKSKVKEIAEAGKEAVDGGSSFLAVKRF 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 99/507 (20%)
egt 13..483 CDD:223071 99/507 (20%)
UGT71C1NP_180536.1 PLN02167 4..478 CDD:215112 99/507 (20%)
MGT 14..465 CDD:273616 95/501 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.