DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT84B1

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_179907.1 Gene:UGT84B1 / 816858 AraportID:AT2G23260 Length:456 Species:Arabidopsis thaliana


Alignment Length:181 Identity:44/181 - (24%)
Similarity:81/181 - (44%) Gaps:28/181 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 MEQFLSEAPNGAILLSLGSNLKEDHLKSSTVQK-----------MFNVLSKLQQKVIWKWDDLDN 341
            ||....:|.:..:.:|.||.|:....:..|:.|           :.....|.|...:     |..
plant   260 MEWLDKQARSSVVYISFGSMLETLENQVETIAKALKNRGLPFLWVIRPKEKAQNVAV-----LQE 319

  Fly   342 IPGESENILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMV- 405
            :..|.:.::. :|.||..:|:|..|:.|:||.|.....|....|.|::|.|.:.|||.:|.::| 
plant   320 MVKEGQGVVL-EWSPQEKILSHEAISCFVTHCGWNSTMETVVAGVPVVAYPSWTDQPIDARLLVD 383

  Fly   406 MHGFGIK---QSI---LTLEE-DSFLQGIRE---VLDNPKYATAVKSFSTL 446
            :.|.|::   .|:   |.:|| :..::.:.|   .:|..:.|..:|..:.|
plant   384 VFGIGVRMRNDSVDGELKVEEVERCIEAVTEGPAAVDIRRRAAELKRVARL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 44/181 (24%)
egt 13..483 CDD:223071 44/181 (24%)
UGT84B1NP_179907.1 PLN02210 1..456 CDD:215127 44/181 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.