DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and AT2G18560

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_179446.2 Gene:AT2G18560 / 816371 AraportID:AT2G18560 Length:380 Species:Arabidopsis thaliana


Alignment Length:336 Identity:74/336 - (22%)
Similarity:126/336 - (37%) Gaps:116/336 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 YLLGNPWEVS---YVP-------GMSVSIK------GGKPLGFGHRVLNLLGSMAQRLFMFIIEL 221
            |:..:.|.::   |:|       |..|.||      |.||:|    ...||.:|..         
plant    45 YIPSHAWFLALIVYLPVLDKVMEGEYVDIKEPMKIPGCKPVG----PKELLDTMLD--------- 96

  Fly   222 RNARIYRE-----------------IYGD--DPTLPSYE---DLHKNISLIFFASHGISEGPI-- 262
            |:.:.||:                 .:|:  ..||.:..   ||::.|.:..:..     |||  
plant    97 RSDQQYRDCVQIGLEIPMSDGVLVNTWGELQGKTLAALREDIDLNRVIKVPVYPI-----GPIVR 156

  Fly   263 ------RPN--------------VPAVIEIGGIQVKEQPERLPQNME-------QFLSEAPNGAI 300
                  :||              |...:..||....||...|...:|       ..|.:.|:   
plant   157 TNVLIEKPNSTFEWLDKQEERSVVYVCLGSGGTLSFEQTMELAWGLELSCQSFLWVLRKPPS--- 218

  Fly   301 LLSLGSNLKEDHLKSSTVQKMFNVLSKLQQKVIWKWDDLDNIPGESENILYSKWVPQVDVLAHPN 365
              .||::.|:|...|..:.:.|                ||...|  ..::.::|.|||::|:|.:
plant   219 --YLGASSKDDDQVSDGLPEGF----------------LDRTRG--VGLVVTQWAPQVEILSHRS 263

  Fly   366 ITLFITHAGKGGLTEAQYHGKPMLALPVFGDQPSNADVMVMHGFGIKQSILTLEEDSFLQGIREV 430
            |..|::|.|...:.|:...|.|::|.|::.:|..||.::...   |..:|.|.|..|     ::|
plant   264 IGGFLSHCGWSSVLESLTKGVPIIAWPLYAEQWMNATLLTEE---IGMAIRTSELPS-----KKV 320

  Fly   431 LDNPKYATAVK 441
            :...:.|:.||
plant   321 ISREEVASLVK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 74/336 (22%)
egt 13..483 CDD:223071 74/336 (22%)
AT2G18560NP_179446.2 Glycosyltransferase_GTB_type 1..380 CDD:299143 74/336 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.