DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt37B1 and UGT2B7

DIOPT Version :9

Sequence 1:NP_525008.2 Gene:Ugt37B1 / 53584 FlyBaseID:FBgn0026755 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001065.2 Gene:UGT2B7 / 7364 HGNCID:12554 Length:529 Species:Homo sapiens


Alignment Length:517 Identity:142/517 - (27%)
Similarity:238/517 - (46%) Gaps:72/517 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LAERGHNVTVV----TILKPPSLHKDINHILVPMEEDILQAFNSVVGGMTKTDNSNAYVSMFRS- 105
            |.:|||.|||:    :||..|:....:...:.|.             .:|||:..|..:...:. 
Human    46 LIQRGHEVTVLASSASILFDPNNSSALKIEIYPT-------------SLTKTELENFIMQQIKRW 97

  Fly   106 -----------VRQLSETFSKMGDVMKQPLVKDLYEH-------PDNKFDLVMVGYFMNCYQLAL 152
                       ..|:.|..|..||:.:: ..||:..:       .:::||::.......|.:| |
Human    98 SDLPKDTFWLYFSQVQEIMSIFGDITRK-FCKDVVSNKKFMKKVQESRFDVIFADAIFPCSEL-L 160

  Fly   153 AHKLKVPLVVALSNPPSFLGYLL-----GNPWEVSYVPGMSVSIKGGKPLGFGHRVLNLLGSMAQ 212
            |....:|.|.:||..|   ||..     |..:..||||.:...:.  ..:.|..||.|::..:..
Human   161 AELFNIPFVYSLSFSP---GYTFEKHSGGFIFPPSYVPVVMSELT--DQMTFMERVKNMIYVLYF 220

  Fly   213 RLFMFIIELRN-ARIYREIYGDDPTLPSYEDLHK-NISLIFFASHGISEGPIRPNVPAVIEIGGI 275
            ..:..|.:::. .:.|.|:.|...||.  |.:.| ::.||..:.:.....|:.|||..|   ||:
Human   221 DFWFEIFDMKKWDQFYSEVLGRPTTLS--ETMGKADVWLIRNSWNFQFPYPLLPNVDFV---GGL 280

  Fly   276 QVKEQPER-LPQNMEQFL-SEAPNGAILLSLGSNLKEDHLKSSTVQKMFNV----LSKLQQKVIW 334
            ..|  |.: ||:.||.|: |...||.::.||||      :.|:..::..||    |:::.|||:|
Human   281 HCK--PAKPLPKEMEDFVQSSGENGVVVFSLGS------MVSNMTEERANVIASALAQIPQKVLW 337

  Fly   335 KWDDLDNIPGE-SENILYSKWVPQVDVLAHPNITLFITHAGKGGLTEAQYHGKPMLALPVFGDQP 398
            ::|  .|.|.. ..|....||:||.|:|.||....||||.|..|:.||.|||.||:.:|:|.|||
Human   338 RFD--GNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQP 400

  Fly   399 SNADVMVMHGFGIKQSILTLEEDSFLQGIREVLDNPKYATAVKSFSTLYRDRPLSPRETLIYWVE 463
            .|...|...|..::....|:.....|..::.|:::|.|...|...|.:..|:|:.|.:..::|:|
Human   401 DNIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIE 465

  Fly   464 YVIRYHGAPHIQSPVVHMSYIAANNLDVYAVILGTIVALCFITKLLFGLVVGKLRKNSRKAK 525
            :|:|:.||.|::.....:::...::|||...:|..:..:.||..........|..:.::|.|
Human   466 FVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt37B1NP_525008.2 UDPGT 12..523 CDD:278624 140/513 (27%)
egt 13..483 CDD:223071 133/473 (28%)
UGT2B7NP_001065.2 UDPGT 24..525 CDD:278624 140/513 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.