powered by:
Protein Alignment Ugt37B1 and T19H12.12
DIOPT Version :9
Sequence 1: | NP_525008.2 |
Gene: | Ugt37B1 / 53584 |
FlyBaseID: | FBgn0026755 |
Length: | 537 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001024147.2 |
Gene: | T19H12.12 / 3565072 |
WormBaseID: | WBGene00044282 |
Length: | 153 |
Species: | Caenorhabditis elegans |
Alignment Length: | 42 |
Identity: | 13/42 - (30%) |
Similarity: | 21/42 - (50%) |
Gaps: | 0/42 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 VLIAGAHGANILGLFTSLSPSHLVIQMSMARILAERGHNVTV 55
:|....|.:.||........||:.....:|.|:|:.||:||:
Worm 11 ILFFKCHSSKILIFNPIYGFSHVKFISKVADIIADHGHHVTL 52
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ugt37B1 | NP_525008.2 |
UDPGT |
12..523 |
CDD:278624 |
13/42 (31%) |
egt |
13..483 |
CDD:223071 |
13/42 (31%) |
T19H12.12 | NP_001024147.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000004 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.